Tag: "pathogen" at biology news

Advances developed to detect bioterrorist agents could find use in protecting food supplies

...curate 99.99 percent of the time and the composite pathogen test has been 100 percent accurate, McCready said. Before breakthroughs in DNA sequencing and other advances, it often required years to find unique DNA signatures to help identify some harmful organisms, McCready said. DNA signatures can now be fou...

As bodies age, disease-fighting cells lose punch

...-experienced B cells were made to fight a previous pathogen and generally do not bind strongly to the current one. Nave B cells can mount a more potent defense because they custom-tailor their antibodies to the current pathogen, allowing the antibodies to bind it strongly. As occurs in many parts of the aging...

Scientists discuss microbial pathogenesis in era of bioterrorism, drug resistance

...man infections. Dr. Kaplan uses the gram-negative pathogen P. aeruginosa as a model for studying biofilm formation, tracking adherence of the bacteria to surfaces, formation of a microcolony, and maturation into a biofilm. P. aeruginosa causes a variety of persistent and chronic infectious diseases, includi...

Framework for rice genome sequencing

... to understand how the pathogen infects the host. Using research funds from Novartis, now Syngenta, the biotechnology firm that sequenced the rice genome, Dean and his colleagues broke up the rice ...

New protein plays espionage role in bacterial attack on plants

...lant protein, called RIN4, interacts with invading pathogen molecules and a protein from within the plant cell...ormation is likely to lead to novel approaches for pathogen control, and to the improvement of disease resistance in plants. The combination of genetics and bi...

UCSF prion finding in mice leads team to urge similar study in cattle

...rt that mice exposed to the lethal prion (PREE-on) pathogen develop high levels of the infectious agent in some skeletal muscle. Until now, scientists have thought skeletal muscle was neither susceptible to high levels of infection, nor infectious. The researchers have not investigated whether high levels of ...

Fighting the spread of sudden oak death

...gist has been tapped to study the newly-discovered pathogen called sudden oak death -- to better understand h...es that nurseries can control the sudden oak death pathogen with the use of a common fungicide. But if an infected plant finds its way to oak forests in the Ea...

New technology may benefit health care, bioterror defense

...logy has applications for very rapid and sensitive pathogen identification, so after September 11 our project took on a different tone and sense of urgency, " Hardin says. "Just as with human genetic information, if you know the genetic potential of an organism, you can determine how nasty it might be. Also, ...

Researchers discover mechanism of plant resistance to pathogens

...e layers that acts somewhat like human skin. If a pathogen is able to penetrate this physical barrier, for example through a wound, the pathogen will usually be detected by receptors on the surface or inside of the plant cells. One of the best ...

Researchers discover mechanism of plant resistance to pathogens

...le layers that acts somewhat like human skin. If a pathogen is able to penetrate this physical barrier, for example through a wound, the pathogen will usually be detected by receptors on the surface or inside of the plant cells. One of the best ...

Study shows plants inherit traits from more than gene sequence alone

...d bal because of its shape, constantly perceives a pathogen attack even though it has the exact same DNA sequence of a non-paranoid plant. The researchers found that the differences between the two plants are not due to genes; rather, the differences are due to factors outside of genes. Moreover, such facto...

Virginia Tech and Johns Hopkins invest $10 million to combat major human diseases

...on to discern how infectious pathogens spread, how pathogen genomes change over time because of various enviro...t of data will then be compiled into an integrated pathogen database to form a common asset against these global maladies," he says. The bioinformatics capabili...

Third piece completes deadly puzzle: Structure of anthrax toxin offers clues to treatment

...lyl cyclase -- but is 1000-fold more active. "This pathogen has evolved a very clever tactic," said Tang. Ede..., Bacillus anthracis was an obscure agricultural pathogen with interesting biological properties. Now anthrax is front and center in every clinician's mind, ...

Tips from the Journals of the American Society for Microbiology: January 2002

...plesand leaf lettuce. The mechanisms by which the pathogen is introduced intothe lettuce plant are not fully ...be poorly treated manure (it is estimated that the pathogen is presentin over 8 percent of dairy and beef cattle) or irrigation water that hasbeen contaminated ...

Agrobacterium genome sequence is complete

...s has completed sequencing the genome of the plant pathogen Agrobacterium tumefaciens. This bacterium has become an essential tool for plant research and biotechnology, and researchers continue to seek ways of harnessing its infectious processes to bio-engineer plants for societal benefit. The journal Scien...

Bacteria's natural foe fights drug-resistant infections

...ers for Disease Control and Prevention (CDC), this pathogen is among the leading causes worldwide of illness a...e specific for Group A streptococci, an infectious pathogen that causes strep throat and flesh-eating disease. Human clinical trials testing the ability of a th...

Tracking path of virulent bacteria via the web

...ratory, Michael Chung '02, began by assembling the pathogen characteristics that the database would need. This included ribotype, DNA sequence and phenotype characteristics. Last fall, Chung began working with a team of computer science students who programmed the software, set up the web server and develop...

NIAID takes next genome step

...tains a complete, coded list of all the proteins a pathogen makes. Researchers use functional genomics to scour that list and determine what role each protein plays. "This is an unprecedented period in infectious diseases research because we now know the genetic information that helps dictate the biology o...

University of Pittsburgh researchers define precursors to cells that control the immune response

...ntigen in the presence of a "danger signal" like a pathogen or infection, they migrate from the skin to the lymph nodes, presenting a processed antigen to T-cells, initiating antigen-specific T-cell immunity. "Scientists have known that LC precursors existed; however, the identification of an immediate LC pre...

Lab scientists develop DNA signatures for salmonella strain that are expected to drastically speed detection

... unique to the enteritidis strain. The most common pathogen of eggs, salmonella enteritidis is estimated to be present in only about one in 10,000 or more eggs. This bacteria only becomes a problem, causing food poisoning for humans, when disease-carrying eggs have not been thoroughly cooked or are left unre...

1 2 3 4 5 6 7 8 9 10

(Date:6/19/2013)... DiscountFurnaceFilter.com, the number one solution for homeowner’s ... Compressor Saver kit at an exceptional price. The 5-2-1 Compressor ... air conditioning unit during start up, saving wear and tear ... unit burn out. , The 5-2-1 Compressor Saver ... uses less power to start and drastically reduces the rush ...
(Date:6/19/2013)... 19, 2013 Kansas City will host its first ... Street Day . A section of Main Street in the midtown ... afternoon of the event. The Main Street Corridor Development ... will help Kansas City join the ranks of dozens of cities ... tool to foster community vibrancy and active lifestyles. , “Ciclovia is ...
(Date:6/19/2013)... June 19, 2013 In 2011, the ... EUR 710 million. Generic drugs form the largest sector, ... value. The pharmaceutical industry is a significant contributor to ... the country’s GDP. Approximately 50% of the total domestic ... pharmaceutical industry. Hemofarm, Galenika and Zdravlje Actavis are key ...
(Date:6/19/2013)... Elsevier, a world-leading provider of scientific, technical ... the publication of the National Osteoporosis Guideline Group ... osteoporosis in postmenopausal women and older men in ... 2009 in Maturitas , the original guidelines ... timely with an additional focus on the management ...
(Date:6/19/2013)... Next Thursday, June 27, 2013, ... organization, and Muzzy Lane Software , a ... the Games for Health community to their interactive ... toward students in grades 4-7 and designed to ... positive choices. The game is part of a ...
Breaking Medicine News(10 mins):Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 2Health News:Main Street Corridor Development Corporation and BikeWalkKC Partner to Host Main Street Day and Kansas City’s First Ciclovia 3Health News:Serbian Pharmaceutical Market Scrutinized by CUBE in Topical Report Now Available at MarketPublishers.com 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 2Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 3Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 4Health News:Adventure Game for Tweens to Promote Healthy Eating will be Unveiled at Games For Health Conference 5
Other Tags
nevadaclocksfitnesskeepsprimevalantiangiogenichorizonsubmitapheresisrenownedareprioritiescortexgambiaopposeshivmaputs