Tag: "pathology" at biology news

World's oldest mouse celebrates milestone birthday

... to Richard A. Miller, M.D., Ph.D., a professor of pathology in the Geriatrics Center of the University of Michigan Medical School. Yoda was born on April 10, 2000 at the U-M Medical School. At 1,462-days-old, Yoda is now the equivalent of about 136 in human-years. The life span of the average laboratory mous...

Gladstone study reveals how genetic factor may increase risk for Alzheimer's disease

...ological Disease (GIND) and assistant professor of pathology at the University of California, San Francisco (UCSF). "With this work, we're a significant step closer to solving the key riddle of apoE4, namely, what is occurring at the molecular level that makes this protein so active in causing neurodegenerativ...

New diagnostic tool brings effective treatment closer to patients

...rofileChipTM (BCPC) should be available for use in pathology laboratories by Summer 2004. One of the biggest ...irst microarray diagnostic tool available to local pathology laboratories, thus bringing the technology closer to the patient", said Dr. Koki. Although a few si...

New approach limits damage after heart attack and improves survival, say Scripps Research scientists

...g laboratory models that are designed to mimic the pathology of heart attacks in humans, Cheresh, Weis, and their colleagues found that a single dose of a compound designed to block this fluid leakage (which is called edema) can, even if given as late as six hours after the event, drastically reduce tissue inj...

Ornamental palms vulnerable to disease

...tive diseases. According to Monica Elliott, plant pathology professor at the University of Florida's Fort Lauderdale Research and Education Center, the palm's anatomy is more similar to that of a corn plant than that of an oak tree, with each stem having a single bud or heart. Once that tissue is damaged, dea...

USC researchers link unusual DNA structure to cancer

... M.D., Ph.D., Keck School of Medicine professor of pathology and biochemistry, the Rita and Edward Polusky Chair in Basic Cancer Research and the study's principal investigator. The paper will be published in the March 4 issue of the journal Nature. Lieber and colleagues had previously used similar techniques ...

New DVD 'virtual' microscope at UNC-Chapel Hill

...st year of medical school, for review while taking pathology or any other time students want to review the basic material, Koch and Petrusz said. They can carry the histology course with them. "In assessing how histology had been traditionally taught to medical students, we decided that traditional methods wer...

Dana-Farber scientists discover natural blocker of HIV-1 virus

... Stremlau and Sodroski, who is also a professor of pathology at Harvard Medical School, set out to discover the factor that efficiently prevents HIV-1 from infecting Old World monkeys (baboons, macaques, and mangabeys from Africa and Asia) and is a hurdle to making models of human AIDS in these monkeys. Auth...

UCSB discovery may accelerate new treatment for global health problem

...uppressed by this type of treatment, then both the pathology of the disease and the continuation of the parasite lifecycle could be halted. The presence of the nonreproductive worms may also help infected people keep their immunity to reinfection....

UC Santa Barbara donates discovery to OneWorld Health that may speed disease treatment

...uppressed by this type of treatment, then both the pathology of the disease and the continuation of the parasite lifecycle could be halted. The presence of the nonreproductive worms may also help infected people keep their immunity to reinfection....

USC researchers produce a hairier mouse

...—Cheng-Ming Chuong, M.D., Ph.D., professor of pathology at the Keck School of Medicine of USC, and his colleagues describe the creation of a mouse in which a particular gene-called noggin-is overexpressed in the skin. (Noggin works by suppressing the action of a protein called bone morphogenic protein, or...

Experimental Biology 2004 - Translating the Genome

...ther subjects related to translating new molecular pathology understanding into medical advances. The American Society for Nutritional Sciences (ASNS) includes 13 minisymposia built around research presentations on aging and chronic disease, diet and cancer, dietary bioactive components, nutrient-gene interac...

Plant pathologists: Rust disease impacting ornamental plant production

... According to Dr. James W. Buck, assistant plant pathology professor at the University of Georgia, a fungal infection called rust has the ability to negatively affect production of many ornamental crops. "Because live plants are shipped all over the country, the risk for rapid disease spread is substantial,"...

JCI table of contents, 16 February 2004

... does indeed make an important contribution to the pathology of asthma. In an accompanying commentary, Timothy Williams from Imperial College London discusses how these findings add spice to the ongoing debate regarding the role of eosinophils in asthma. Despite early setbacks understanding the mechanisms by ...

Studies offer new insight into HIV vaccine development

...under the direction of David Watkins, professor of pathology at UW-Madison and senior scientist at the Wisconsin National Primate Research Center. Watkins' team produced an "escaped" AIDS virus that mimicked events that occur in HIV infection when the virus mutates to become unrecognizable to killer cells kno...

Pioneer in the genetics of programmed cell death honored

...ley J. Korsmeyer, M.D., Sidney Farber professor of pathology and professor of medicine at the Dana-Farber Cancer Institute at Harvard Medical School, and a Howard Hughes Medical Institute investigator, is the recipient of the seventh annual Pezcoller Foundation-American Association for Cancer Research Internat...

Optically recording millisecond brain nerve impulses

... further development, we should be able to see how pathology affects electrical signals. We'd like to know, for example, how much Alzheimer's plaques affect the signal transmission in axons." Multiphoton microscopy, including second-harmonic generation, produces high-resolution, three-dimensional pictures of t...

Immune system's attack dogs kept on genetic leash

...., assistant professor of internal medicine and of pathology and immunology. "We're now thinking these resting cells actually are very metabolically active, and they are kept in a quiescent state by genes actively working to shut down activating proteins." In the new study, Peng and colleagues showed for the ...

Making of mouse marks move toward 'mitochondrial medicine'

...he numbers are so low," says Pinkert, professor of pathology and laboratory medicine, who was attracted to the university three years ago by a thriving community of researchers focusing on genetic engineering and mitochondrial biology. "It's important to work this out, if we are to develop models of disease th...

Smallpox in 50-year-old tissues detected by integrated diagnostics approach

...pabilities that reside at USAMRIID--from classical pathology methods to state-of-the-art molecular diagnostics," said Colonel Erik A. Henchal, commander of the Institute. "The combination of these tools into an integrated system, as envisioned by USAMRIID scientists, could change the way that biological agents...

1 2 3 4 5 6 7 8 9 10

(Date:8/29/2014)... Pursuing its deepest desires to help build ... stunning new design that promises to redefine the global ... surrogacy platform has witnessed a 42 percent increase in ... month, the FindSurrogateMother.com community is formed by hopeful parents ... — the precious gift of life. , Whether intended ...
(Date:8/29/2014)... News) -- If you have bunions, taking care of them ... expert says. A bunion is a bump that forms ... tissue moves out of place and extends beyond the normal ... pain and may require surgery to correct, said Brent Rosenthal, ... Freehold, N.J. To prevent bunions, avoid wearing shoes with ...
(Date:8/29/2014)... NEW YORK August 29, 2014 - Despite US ... obesity, there are many barriers, several of which may ... study by researchers at NYU Langone Medical Center published ... General Internal Medicine ( JGIM ). , David ... Department of Internal Medicine at NYU Langone, and colleagues ...
(Date:8/29/2014)... AURORA, Colo. (Sept. 2, 2014) A team of ... has reported the breakthrough discovery of a process to ... patients. These findings could have implications that extend beyond ... and autoimmune diseases., In an article published ... the Charles C. Gates Center for Regenerative Medicine and ...
(Date:8/29/2014)... 29, 2014 Today, NBC’s “The ... who profiled a handful of safe, back to ... Research. This year, many schools will include earphones ... innovator of hearing wellness solutions, offers the best ... Earphones, offered in yellow, pink and black, sound ...
Breaking Medicine News(10 mins):Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 2Health News:FindSurrogateMother.com Set to Unveil Stunning New Design as Member Sign-ups Increase by 42% since January 3Health News:Take Steps to Control Bunions 2Health News:Options for weight loss your primary care doctor might not know about 2Health News:CU scientists' discovery could lead to new cancer treatment 2Health News:The Today Show Features ETY•Kids® Safe-Listening Earphones by Etymotic 2
Other Tags
hayfevershotantelopesaigakineticsilymarinplasticityinvasionsendocrineaaccmightdiscovereddefectataxiafriedreichreverses