Tag: "perception" at biology news

Cooking And Salad Oils Could Lubricate Cars, Boats, Machines

...s. The company's success challenges the widespread perception that vegetable oils oxidize too rapidly to be used in engines. Duda said there has been continuing interest in vegetable oil-based lubricants for many years because they are more environmentally friendly. They can be produced...

Human-Like Ability, Categorical Perception, Found In Insects

...e of neurobiology and behavior who gave crickets a perception test originally developed for human infants. "Cri...tion," Wyttenbach said, explaining that continuous perception allows human color vision to discriminate hundreds of variations between "blue" and "green," even th...

Early Menarche Puts Young Girls In Peril

... Her analysis on the paradigm shift in girls' self perception from the l9th to 20th century, however, is of particular interest to American psychologists. Brumberg calls for a new era of "girl advocacy" in which multigenerational dialogues on sexual ethics would better prepare girls in ways that go far deeper t...

At-Risk Women Want Breast Cancer Gene Test--If 'Pros' Outweigh 'Cons'

... woman's desire to be tested hinges largely on her perception that there ismore to be gained than lost by having this knowledge," said Paul Jacobsen, PhD,lead author of the study. "These findings underscore the importance ofproviding counseling to women who plan to undergo genetic testing for breastcancer susc...

Columbia Biologists Match Odor Receptor To Odor; Research Uncovers How Sense Of Smell Works; First Aroma Scientists Detect Is That Of Meat

...ting in motion a cascade ofreactions that create a perception of odor in the brain. "I believe this experiment will prove to be a Rosetta stone forolfaction, in that we can now begin to match odorants to receptors and decodethis elusive sense," said Darcy Kelley, professor of biological sciences atColum...

Low Cholesterol? Reduced Sodium? What Do These Terms Really Mean?

...ficantly overestimated all seven. Furthermore, the perception of each quantifier term was affected by the dietar...ns. However,it appears that there is no consistent perception in this regard. Therefore, theFDA must embark on an educational campaign to educate consumers on the...

Microsurgery Made More Accurate With Virtual Measuring Tool

...scopic operating microscopes allow for added depth perception through retinal disparity cues not provided by mon...in R.A., Corso G.M., 'Relevant cues for the visual perception of depth: Is where you see it where it is?' Proc. Human Factors and Ergonomics Soc. 38th Annual Meet...

AAAS Forum To Examine American Attitudes

...ll address issues of safety, nutrition, and public perception andwill provide opinions to a European Union public forum in June which will assessthe public attitudes and policies of different nations regarding biotechnologyissues. The forum is sponsored by the American Association for the Advancementof Science ...

DFG To Fund Six New Research Units

...asis. Clinical studies, an analysis of the spatial perception of humans, monkeysand bats as well as complementary theoretical studies will try to explain the mechanismsinvolved in acquiring and using spatial information. The work planned also promises tostimulate the optimisation of technical systems (robots) a...

New Tests Demonstrate MuchLarger, More Specific Immune Responses To Viruses

...n our previousestimates, and radically changes our perception of the T cell response toviruses," says Dr. Ahmed. "This research should prove very important forvaccine development, because you want a vaccine to induce a good response, andthis research allows us to see directly what a good response is." ...

The Touch Of Phytophthora

...rior to penetration of the plant cell wall, the perception of a local mechanical signal from the emerging infection tube is sufficient to induce the generation of ROI, cytoplasmic rearrangements, and the expression of some infection-related genes. To trigger local cell-wall thickening, the fungal...

Alaska Sea Grant To Convene Ecosystem Considerations In Fisheries Management Conference

...el. In the last 10 years, there has been a growing perception that it is not effective to base fisheriesmanagement policies solely on single-species considerations. Large decadal shifts in speciescomposition, abundance, and productivity are common, and are not predictable from single-speciesmodels. Climate regi...

At Night, Birds May Review The Songs They Learn During The Day

.... "A speculative and provocative theory about song perception has been replaced byone about song learning and sleep," says Margoliash. "This is hardly the turnof events we expected when we started these studies." Margoliash wants to compare the RA bursting patterns seen in sleeping birds topatterns generated i...

Hopkins, Israeli Scientists Link Soybeans With Pain Relief

...people, strong individual differences exist in the perception ofpain," says Hopkins neurosurgeon James N. Campbell, M.D., one of theresearchers. "And while this is undoubtedly due to a number of factors, the ideathat diet could affect the pain experience offers fascinating possibilities forunderstanding our vul...

UCSD And NIH Researchers Isolate Candidates For Genetic Basis Of Human Taste

...vides the groundworknecessary for manipulating the perception of taste and devising methods tostimulate or block...werful sensory systems in the animalkingdom. Taste perception gives mammals the ability for basic food appraisal andvaluable discrimination power. Sweet receptors...

New Technology Turns French Fry Oil Into Diesel Fuel

...hat bears would chase the vehicles in the mistaken perception they were chasingfinger-licking-good meals on wheels. "We told the park service that bears don't often eat at Kentucky Fried Chicken,"Fox laughs while explaining how the service's fears were allayed. YellowstoneNational Park later began experimenting...

Gene Therapy For Pain

...n signals beforethey reached the brain, where pain perception occurs. The researchers observed that beta-endorphin levels in the spinal fluidincreased nearly 10-fold following a single injection of virus. Cellularanalysis confirmed that sheath cells, not spinal cord neurons, were the sourceof beta-endorphin. T...

Some Atlantic Coast Beaches Are Shrinking While Florida's Beaches Better Off Than Most

...e even getting larger. Contrary to popular perception and the trend in most other states on theEast Coast, Florida's beaches generally are not falling victim to coastalerosion or steadily rising sea levels, a new University of Florida studyhas found. In fact, despite areas of serious erosion, east coast...

Vanderbilt Researcher: Human Brain Has Great Sense Of Timing

...eption," heexplained. "Vision - and in fact all of perception - happens quickly andeffortlessly, yet the steps i...not been mastered. Yet our brains accomplishvisual perception every waking moment of our lives." Blake, who served as chair of Vanderbilt's psychology department ...

UCSF-Led Team Offers New Insight Into Neurological Basis Of Dyslexia

...ords to the regions of the brain involved inspeech perception and reading," he said. The authors emphasize that their findings do not discount the additionalinvolvement of higher levels of brain processing in dyslexia, where more complexcombinations of information lead to the recognition and interpretation ofs...

1 2 3 4 5 6 7 8

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker