Tag: "persist" at biology news

Northwestern Scientists Discover How Herpes Simplex Virus Infects Cells

... can establish latent infections innerve cells and persist indefinitely with periodic reactivation of thevirus. Consequences of viral replication include cold sores and feverblisters, similar lesions on the genitalia, corneal destruction,encephalitis and severe disease of newborns. The virus can bind to many...

Stuttering Appears To Have Strong Link To Family Genes, Researchers Say

...hearticle. They further concluded that "people who persist in stutteringhave additional genetic factors that ...berg," hesaid. Finding clues as to which kids will persist -- the aim of the overallproject -- will help to target them for early intervention. The geneticlink...

Common Childhood Virus Poses Threat To Adults, Research Shows

...atients inhale it through a mist. Symptoms of RSV persist even after the patient is discharged from thehospital. “When people go home, it may be a while before they feel completelybetter, because the damage to their airways will take at least 8 weeks toheal,” said Murry. “So they’ll rem...

Report Notes Difficulties In Eliminating E. Coli O157:H7 From Food Supply

...e. Despite this, the bacteria have the ability to persist in and reinfectcattle, even those that have a strong immune response to it, Buchanan and Doylewrote. Results of two major U.S. surveys indicated that about 3 percent ofdairy calves and 2 percent of feedlot cattle had E. coli O157:H7. Young animalst...

Limits Of Life On Earth: Are They The Key To Life On Other Planets?

...oworkers will examine whether a layer of water can persist below the surface of a planet's moon, maintained as liquid by tidal interaction between planet and moon. They will analyze such interaction between Pluto and Charon as well as between Uranus and its "satellites." -NSF- LIST OF LExEn AWARDS...

Vertex Pharmaceuticals Researchers Report Three-Dimensional Structure Of Hepatitis C Helicase Enzyme; Report In Structure

...ents, HCV establishes a chronic infection that can persist for decadesand eventually lead to cirrhosis, liver failure and liver cancer withdevastating health consequences. Sources at the U.S. Centers for DiseaseControl and Prevention (CDC) recently estimated that approximately 3.9 millionAmericans, or more...

Leftover Fetal Cells May Affect Development Of Scleroderma

..., sonon-self maternal cells could also engraft and persist in a child. To explore further whether microchimer...ears ago, Dr. Bianchireported that fetal cells can persist in the mother's circulation up to 27 yearsafter pregnancy. "When the finding came out about fetal c...

Water Quality In Indiana's White River Basin Affected By Urban And Agricultural Activities

... long been banned (chlordane, dieldrin, and PCB's) persist in streambed sediments and are concentrated in organisms such as freshwater clams. Fish communities have significantly improved since the early 1970's, although degraded communities of fish still are found in streams with poor water quality. Some st...

Water Quality In Georgia-Florida Coastal Plain Affected By Agricultural And Urban Activities

...ents in the study area. Organochlorine pesticides persist in streambed sediments -- concentrations exceeded guidelines for the protection of aquatic life in 22 percent of 54 streambed-sediment samples. Most exceedances were for chlordane and DDT which have been banned in the U.S. for many years. Lead, chr...

The First Rejection: Eggs Sequester Bits Of Sperm For Later Elimination

...hich enters the egg entirely during fertilization, persist in the developing midgut of the embryo and are excreted soon after the larva hatches, reports Tim Karr , a developmental biologist at the University of Chicago, and Scott Pitnick, an evolutionary biologist at the University of Syracuse in the May 7 ...

New Tests Demonstrate MuchLarger, More Specific Immune Responses To Viruses

...out 95 percent of the Tcells die and the remainder persist to become memory cells poised to respond tofuture invasions by the same virus. The assays used in the Emory study werealso able to detect memory CD8+ T cells specific to the LCMV virus more than oneyear after infection. "One of the hardest ...

New Herpesvirus Receptor Discovered That Allows Entry of Both Herpes Simplex-1And -2 And Animal Herpesviruses Into Human Cells

...can establish latent infections in nerve cells and persist indefinitely withperiodic reactivation of the virus. Consequences of viral replication includecold sores and fever blisters, similar lesions on the genitalia, cornealdestruction, encephalitis and severe disease in newborns. The virus can bind tomany ...

Edible Lily Plant Yields A Natural Pesticide

...tage over synthetic organochlorinepesticides which persist for a long time and have resulted in manyenvironmental problems. # # # # A nonprofit organization with a membership of more than 155,000 chemists andchemical engineers, the American Chemical Society publishes scientificjournalsand databases, conve...

Pool Of Latently Infected, "Resting" Cells Established Early In HIV Infection

...safe havens of resting CD4+ T cells, the virus may persist for years,despite highly active antiretroviral therapy (HAART), which is generally acombination of three drugs, including a protease inhibitor. "Latent reservoirs of HIV, including resting CD4+ T cells, present a formidableobstacle to the ultimate ...

Brain Study Sheds Light On The 'Phantom Limbs' Of Amputees

... be movingtoward the remaining stump; and pain can persist in the limb that is long gone. Many people are at risk for these phantom-limb effects; about 100,000amputations occur each year in the United States alone. In this week's issue ofthe journal Science, Edward Jones, director of the UC Davis Center for...

Genetic Uniqueness Threatens Florida Manatee's Future

...neighboring manatees in theirplight to survive and persist in Florida. "The good news is that we know about it before it's too late."...

Treatment With IL-2 Plus HAART Markedly Reduces HIV In Immune System "Hiding Places"

... T cells are among the "safe havens" where HIV may persist for years- sewn into the cells' genes - despite aggressive three-drugantiretroviral therapy. In resting CD4+ T cells taken from the bloodstream ("peripheral blood")of a small number of study patients receiving IL-2 plus HAART, theresearchers have bee...

Ancient Volcanic Cataclysms Discovered In The Indian Ocean

... the magnitude and altitude of the material, itmay persist for several years. This can cause considerable short-termenvironmental effects, such as those resulting from the recent eruption of MountPinatubo in the Philippines....

Autoimmune Diseases May Be Triggered By Cells From Your Mother

...onin which small numbers of another person's cells persist in the body-could beinvolved in some cases of autoimmunity. The idea is bolstered by the fact thatautoimmune diseases are more common in women, who may be repeatedly exposed totheir fetuses' cells while pregnant. Two years ago, researchers in...

UCSF-Led Team Offers New Insight Into Neurological Basis Of Dyslexia

...w that these fundamental listening problemsclearly persist across a lifetime, even while the basic speech receptionabilities of these individuals can ultimately achieve a relatively normalcompetency." Co-authors of the study were Henry Mahncke, Ph.D., a research fellow in the KeckCenter at UCSF; Talya Salz, ...

1 2 3 4 5 6 7

(Date:5/24/2015)... 24, 2015 Women’s Excellence ... pressure measurements in patients’ bladder and urethra. This provides ... it if they have reported symptoms of stress urinary ... Women’s Excellence in Bladder Control is a comprehensive center ... or problems with overall control of their bladder. The ...
(Date:5/24/2015)... 24, 2015 Indiana Fiber Network, LLC ... Midwest Telecom of America, Inc. (MTA) has selected IFN ... Cory Childs, IFN Enterprise Sales Manager, fiber route diversity ... “IFN’s fiber transport provides MTA with the diverse fiber ... Tier 1 Internet and voice carriers located at Henry ...
(Date:5/23/2015)... D.C. (PRWEB) May 23, 2015 On ... of powers of a youngster's yogic power learned through ... Sri Nithyananda Swami in Bangalore, India. , Yogamaatha, a ... more than 50 high profile professionals attending the 2015 ... by reading fluently -- blindfolded. , In a ...
(Date:5/23/2015)... (PRWEB) May 23, 2015 Manufacturers are now ... Performance Factor (HSPF) of 8.2. Experts in the field agree ... benefit consumers. , The HSPF score is what miles per ... more efficient the unit. Although the minimum HSPF score has ... heaters with an HSPF score north of 12. Indeed, the ...
(Date:5/22/2015)... Pasadena, Calif. (PRWEB) May 22, 2015 ... where technology, communication and capacity are intersecting to ... and across society, the opening speaker at WesternU's ... , California Lieut. Gov. Gavin Newsom, a former ... was the keynote speaker at the graduation ceremony ...
Breaking Medicine News(10 mins):Health News:Indiana Fiber Network, LLC Enables Midwest Telecom of America with Fiber Route Diversity 2Health News:Nine-Year-Old Reads Blindfolded at Business Advocacy Summit 2Health News:Nine-Year-Old Reads Blindfolded at Business Advocacy Summit 3Health News:Parker & Sons Welcomes the Department of Energy’s Water Heater Regulation 2Health News:Newsom to WesternU Grads: The Future is Inside You 2Health News:Newsom to WesternU Grads: The Future is Inside You 3
Other Tags
entryguardpasswordshupobassvalvesimplifyarisingfilmmakersnanopatternswritingfourfoldcubsdefineshrsatrendy