Tag: "persons" at biology news

Seeing How the Brain Changes During Aging

...e Brookhaven team used these radiotracers to study persons ranging inage from 23 to 86. The researchers asked each person to perform motor andcognitive tests and then used the PET scan to "watch" how their dopamine systemsworked. The older the person, the more poorly they performed the tests and the lower t...

Studies Underscore Link Between Nutrition And Nonmelanoma Skin Cancers

...ancer," Arbesmansaid. "Another recommendation for persons at risk might be to increase theirintake of foods rich in Vitamin C to consume 500 milligrams per day. They alsomay benefit from increasing their intake of foods containing beta carotene, suchas carrots, sweet potatoes and broccoli." Vitami...

Short-Course TB Prophylaxis Effective In HIV-Infected Individuals

... to the year-long regimen currently prescribed for persons co-infected with HIV and TB bacteria, ...could have a very positive impact on the health of persons infected with both HIV and TB," says NIAID Director Anthony S. Fauci, M.D. "TB and HIV ...

USGS Cautions Proper Use Of Pepper Spray To Avoid Bear Attacks

...should not be kept in or near thetents of sleeping persons because of the possibility that red pepper sprayresidues on canister nozzles may attract bears. Smith's work has been reviewed by other bear biologists in the U.S.Department of the Interior and submitted for publication in the Wildlife ...

Good Ergonomics Is Good Economics

...n human-system interface technology that qualifies persons as human factors/ergonomics professionals. Indeed,...ons. This, indeed, is a concern, particularly when persons lacking professional training pass themselves off as ergonomists or human factors professionals or t...

Family Ties To Sudden Cardiac Arrest; Study Finds Risk Goes Up 50 Percent

...ation of these genes and risk factors. Or, persons with a family history of sudden cardiac arrest may...to an increase of cardiac arrest of one per 10,000 persons to 1.5 per 10,000persons annually; the risk goes up to 5.0 for current smokers, notes theprincipal i...

Doublecortin : A Novel Gene Involved In Cortical Development

...develops and yield a tool forprenatal diagnosis in persons at risk. This work is published in Cell (January 9...cond, it provides a tool for prenatal diagnosis in persons at risk. The work of INSERM 129 was done in collaboration with several hospitalneuropaediatrics dep...

Increased Amount Of Enzyme In Brain May Be Marker Of Alzheimer's Disease

...s colleagues tested brain tissue specimens fromtwo persons with Alzheimer's disease and specimens from four non-dementedpersons for the presence of BChE and its confirming markers. Their resultsshowed that only the compact and neuritic forms of amyloid plaques had BChE. (Itis this neuritic stage that is most...

First Selenium-Based Orally-Active Antihypertensive May Lead To New Family Of Therapeutic Agents

...can play a role indetermining the survival rate of persons infected with the HIV virus,the rate of certain cancers, and cardiovascular health. A landmarkstudy reported in the December 25, 1996 issue of the Journal of theAmerican Medical Association reported the potential of selenium inreducing cancer rate...

NIDR Supports Total Genome Studies Of Major Oral Pathogens

...anging from mucosal infections in generallyhealthy persons to life-threatening systemic infections in individuals withimpaired immunity. Candidiasis is one of the earliest and most commonopportunistic infections to occur in the oral cavity of HIV-infectedindividuals. Oral candidiasis causes pain and discom...

NIH Office Of Dietary Supplements Expands Research Support

...antioxidants in preventing cataract development in persons with diabetes. A key aim of this study will be to determine if antioxidants can prevent the production of specific toxic compounds found in the lens of the diabetic eye. The ODS will cosponsor with the National Institute of Child Health and Human De...

Herpes-Based Gene Therapy Is Key To Promising Liver Tumor Vaccine

...adership role in defining the standard of care for persons with cancer. In 1996, Memorial Sloan-Kettering was named the nation's best cancer center by U.S. News and World Report for the fourth year in a row....

Northwestern Scientists Discover How Herpes Simplex Virus Infects Cells

...tanding how recurrent herpeticdisease can occur in persons with normal immune systems and will lead todevelopment of new classes of antiviral drugs," said Patricia G. Spear, whoheads the laboratory at Northwestern where the discovery was made. Spear isthe Guy and Anne Youmans Professor and chair of the depar...

1 2 3 4 5 6 7 8 9 10

(Date:3/5/2015)... 2015 Taking center stage at ... Texas April 9-11th is IDRevolution hosted by IDLife ... nutrition. IDLife offers a variety of nutritional ... customized approach to vitamin supplementation is based upon ... free HIPAA compliant online assessment and ends with ...
(Date:3/5/2015)... 2015 Supply & Demand Chain Executive ... “Pros to Know” in the supply chain industry, and ... MEBC’s leadership team were included on this year’s list! ... this award due to their hard work, their commitment ... meeting and resolving client needs and challenges. ...
(Date:3/5/2015)... For PASCHA Chocolate, less is more. ... robust flavor of the cacao bean bursts through without ... free from peanuts, nuts, dairy, soy, eggs, fish, wheat, ... 8th at Expo West., ,    NEW PASCHA Make ... new ground with their New PASCHA Make Me Smile! ...
(Date:3/5/2015)... 2015 Dr. Jonathan Glashow a board ... has been named by Castle Connolly as ... Dr. Glashow has been selected by Castle Connolly Medical ... top specialty care doctors in the tri-state metropolitan New ... program, which carefully screens and selects doctors through a ...
(Date:3/5/2015)... Minneapolis, Minn. (PRWEB) March 05, 2015 ... authority, invites healthcare organizations to participate in its ... includes data from executive and director-level positions, and ... , Last year’s report featured data on ... 28 independent children’s healthcare organizations and 7 subsidiary ...
Breaking Medicine News(10 mins):Health News:IDLife Partners John C. Maxwell and Troy Aikman speaking at IDRevolution in Fort Worth, TX April 9th-11th, 2015 2Health News:MEBC Leaders Awarded Supply Demand Chain Executive Pros to Know Title For 2015 2Health News:PASCHA Allergen Free Organic Chocolate to Appear at Natural Products Expo West March 6-8, 2015 2Health News:Dr. Jonathan Glashow, NYC Orthopedic Surgeon, Named Top Doctor: New York Metro Area 2Health News:Participation Is Now Open For INTEGRATED Healthcare Strategies 2015 Children’s Hospitals Executive Compensation Survey 2
Other Tags
behaviorseducationalbakerfungidonekoreacomparingbogsdisablingminorgainingfaminevargervikpharmacologyhershjones