Tag: "point" at biology news

'Dead zone' area shrinking, Texas A&M prof says

...f from the Mississippi River, while other theories point to more complicated and interrelated factors. "Just a few weeks before we went on our research cruise, other teams in the area reported seeing few if any fishing boats in the dead zone area," DiMarco says. "But we were surprised to see a lot of fishi...

Researchers find color sensitive atomic switch in bacteria

...o-machinery as a color-sensor; however the authors point out that this practical application is years in the future. First author of the paper is Lutz Vogeley, a graduate student in the UC Irvine Department of Molecular Biology and Biochemistry. Senior authors are Spudich and Hartmut Luecke, Ph.D., profess...

Alzheimer's disease is not accelerated aging

...in people living with Alzheimer's. Together, these point toward a disrupted network in the brains of patients with Alzheimer's disease, which includes the medial temporal lobe and other regions of the brain that undergo atrophy and reduced glucose metabolism, and appear to be involved in memory impairment....

'Most recent common ancestor' of all living humans surprisingly recent

...about 3,000 years ago, and the identical ancestors point was as recent as several thousand years ago. The paper suggests, "No matter the languages we speak or the color of our skin, we share ancestors who planted rice on the banks of the Yangtze, who first domesticated horses on the steppes of the Ukraine,...

Gene clusters predict atherosclerosis severity, susceptibility

...this study, I am extremely encouraged that at some point after further research we will be able to help fulfill the promise of personalized medicine," Goldschmidt. "This would not have been possible without the collaborations across this institution, as well as the support of the National Institutes of Hea...

UCSF scientist Joe Derisi named MaCarthur Fellow

...ccess to scientific information, DeRisi has made a point of posting instructions on his website for making microarrays, and has given several workshops on their construction at Cold Spring Harbor and UC Santa Cruz. "Joe has made a monumental effort to improve technology, creatively app...

A test case for DNA barcodes to identify species

... from the University of California, Berkeley, also point out in the correspondence section of this issue, the Hebert et al. study is "not yet a definitive test of the utility of DNA barcoding for either diagnosis of individuals or discovery of species." Future studies will have to determine whether these r...

$2.7 million grant to support creation of virtual zebrafish atlas

... to share our detailed zebrafish anatomy, from any point in its lifespan, with researchers around the globe. This data-sharing will speed the pace of discovery for a number of human diseases." The atlas will allow scientists to access images of the anatomy of healthy zebrafish to compare to the zebrafish u...

Binocular rivalry: Fulfilling visual expectations

...not recognize walking figures until long after the point at which information from the two eyes is combined, these results show that once a walker is recognized it can cause dominance of signals from one eye and suppression of signals from the other. This is strong evidence that the brain's expectation tha...

ORNL's Delmau joins Technology Review's list of top young innovators

...f scientific achievement and, coming at this early point in her career, also signifies her tremendous potential in the field of chemical sciences," ORNL Director Jeff Wadsworth said. Her work has centered on technologies for the treatment of nuclear wastes in Europe, Japan and the United States. Delmau...

Brown ecologist garners major National Science Foundation grant

...imate change will affect crops and wild plants and point out ways to conserve species. The results may even shed light on how complex environmental cues affect animals, including humans, who share many of their genes with Arabidopsis....

Cockroach-like robot leads new research effort

... A cockroach-like robot named RHex is the starting point for a major project to understand animals' most distinguishing trait - how they move without falling over. The National Science Foundation (NSF) announced today (Thursday, Sept. 16) a $5 million, five-year grant to the University of California, Berk...

USC study links historical increases in life span to lower childhood exposure to infection

...hair in the Neurobiology of Aging. "Our main point is that in historical times when there was a lot of childhood mortality, even kids that didn't die got chronic infections. Those chronic infections from childhood onward accelerated vascular and other diseases," he said. Finch and Crimmins, hol...

New fruitfly model of diabetes has future implications for pancreatic cell transplantation

...sugar is regulated at a very basic level. "At this point investigators would like to understand how this ancient mechanism for cells that sense the nutrient and energy status of an animal can adjust an animal's growth and metabolic state," he says. "Now we have a model for that." Coaxing stem cells to...

Human chromosome 5 final sequence analysis released to public

...tic sequence, researchers have reached the halfway point in dotting the i's and crossing the t's of the genetic sentences describing how to build a human. The newly finalized chromosome 5 is the 12th chromosome polished off, with 12 more to go. As the new sequence reveals, this chromosome is a genetic behe...

Ecology of infectious diseases grants awarded

...anges and the emergence of infectious diseases may point to underlying and predictable ecological relationships." Yet both basic and applied research in infectious disease ecology has been largely piecemeal, said Scheiner. According to infectious disease specialists and ecologists, the potential benefits ...

Researchers identify distinctive signature for metastatic prostate cancer

... Smoothened suggesting that gene may be "a focal point of regulation in tissue regeneration and tumorigenesis." They also found they could convert low-metastatic cells into highly metastatic tumors by activating the Hedgehog pathway. "We actually found we could interconvert the two kinds of cell lines i...

ConocoPhillips & Conservation International launch 'Biodiversity Action Plan' in Venezuela

...t be seen as an end product, but rather a starting point for generating knowledge, interest and support for promoting regional conservation and sustainable development through greater cooperation and dialogue with key stakeholders. The full report detailing the AquaRAP and Biodiversity Action Plan can be d...

Researchers report new gene test for isolated cleft lip and palate

...f Medicine. "This study shows that we've reached a point where it's possible to take blood samples from parents, test certain genes, and determine whether their risk for a second child with cleft lip or palate is, say, 1 percent or 20 percent," said Jeffrey Murray, M.D., a scientist at the University of Io...

PNNL lands $10.3 million NIH biodefense contract to unlock proteomes of salmonella and pox

...proteins interact with which human host cells will point drug designers toward quick and effective treatments during an outbreak. To conduct the analysis of these microbial proteins, scientists at PNNL will use proteomics instruments and approaches unavailable elsewhere that simultaneously combine the high...

1 2 3 4 5 6 7 8 9 10

(Date:6/18/2013)... "What if adding one simple act ... your health and well-being? Well, there is something easy ... "It is called Skin Brushing ." , Skin ... lost art. Now, people are rediscovering this great health ... so do certain health conscious people. Sublime Beauty® wants ...
(Date:6/18/2013)... New York, New York (PRWEB) June 19, 2013 ... dedicated to protecting the rights of victims injured by ... on behalf of an Arizona woman who alleges that ... The suit was filed on May 30th in the ... Virginia (Civil Action No. 2:13-cv-12677) in the multidistrict litigation ...
(Date:6/18/2013)... Looking for a way to break out of the ... IWALKAWAKE is a guide to unlocking one’s true potential through ... on harnessing the powerful and abundant spiritual presence that is ... guide to finding one’s true purpose and potential. These nine ... to reach their true potential. The awakenings deal with subjects ...
(Date:6/18/2013)... Daily Gossip Magazine has always kept its readers entertained by ... The magazine has decided to prepare readers for the summer ... every week . , According to Daily Gossip ... who are looking to get insights into this type of ... food is almost entirely based on healthy, yet tasteful products. ...
(Date:6/18/2013)... 18, 2013 SEATTLE, WA—A Washington state ... Fairview, Oregon, claiming he fell ill with a hepatitis ... pomegranate seed blend. The complaint was filed in ... Clark, the Seattle-based law firm that has filed ... to the complaint, Brian Brothers consumed “Townsend Farms Organic ...
Breaking Medicine News(10 mins):Health News:The Easiest Way to Contribute to Better Health and Well-Being Starting Today and for Under $20, Says Sublime Beauty® 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 2Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 3Health News:Boston Scientific and American Medical Systems Named in Transvaginal Mesh Lawsuit Filed by Parker Waichman LLP on Behalf of Arizona Woman 4Health News:Anabolic Cooking Book Review Exposes Dave Ruel’s Top 10 ‘Anabolicious’ Recipes for BodyBuilders 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 2Health News:Marler Clark, Washington Resident Sue Townsend Farms Over Hepatitis A 3
Other Tags
comparablemarimastatketektenthdarklyairwayeditsfluorideappropriationsconveysasmusualunprovengambiaopposeshivma