Tag: "preclinical" at biology news

Aptosyn™ (exisulind) and other SAANDs target early event in cancer; AACR presentations detail novel apoptotic pathway

...ings with the broad pro-apoptotic activity seen in preclinical testing across a large number of cancers, and clinical results with Aptosyn™ in patients with Familial Adenomatous Polyposis (FAP) as well as prostate cancer, we believe that SAANDs target an early, common event in the development of a significan...

Exisulind (Aptosyn™) and other SAANDs compounds halt prostate cancer cell growth by two mechanisms

...their Cell Pathways' collaborators presented their preclinical findings on Sunday April 2, 2000 at the annual meeting of the American Association for Cancer Research (AACR) in San Francisco. The researchers also demonstrated in a prostate cancer cell line that exisulind (Aptosyn™) and two other SAANDs,...

Gel being developed to allow women to control fertility,reduce sexually-transmitted disease risk, including HIV, herpes

...g to produce Z-15 in kilogram quantities for final preclinical assessment and phase one clinical trials. A patent is pending on the product. "Drs. Doncel and Stephen D. Bryant of Buckman Laboratory International of Memphis, Tenn., contributed substantially to the success of this research," says Gandour. The Buck...

Researchers discover new vein of cancer-fighting agents

... which may begin in one or two years after further preclinical testing. "Tumors are highly dependent on new blood vessels for their growth, and canstatin appears to stop the division of endothelial cells as they begin multiplying to form new blood vessels," says Kalluri, who is also an assistant professor of m...

Vion's TAPET® administered to first patients in Phase I human intratumoral safety trial at the Cleveland Clinic Foundation

...echnology, are highly attenuated bacteria that, in preclinical studies, have demonstrated preferential replicatio...a have demonstrated an excellent safety profile in preclinical toxicology studies. Preferential replication allows the bacteria to produce and deliver a variety o...

Smells may trigger alcohol craving, and relapse, among alcoholics

...or sound -- and relapse. "This is one of the first preclinical studies to look at the neurochemical mechanisms involved in alcohol craving and relapse," said Katner. "If we can understand the processes involved in relapse, then we can 'tease' things apart more and screen for possible therapeutic agents." Katne...

Harbor Branch to receive $2.1 million of a $4.9 million multi-institutional grant to discover new natural product leads for cancer chemotherapy

...a deep water sponge and is now undergoing advanced preclinical testing at Novartis as an anticancer agent. Microorganisms such as bacteria and fungi found in the marine environment have been studied to a far lesser extent but show great potential in the production of novel chemicals. Many marine microorganisms ...

University of Pittsburgh Medical Center performs first in vivo gene therapy for hemophilia A

...ed with the disease," added Dr. Ragni. "In preclinical models, we achieved continuous long-term production ofcirculating FVIII. We are now initiating testing in humans; an importantmilestone for Chiron," said Lewis (Rusty) T. Williams, Ph.D., M.D., Chiron'schief scientific officer and president of its r...

Immunex Corporation and Genentech, Inc. join forces to develop TRAIL/Apo2L in cancer

...mmunex and Genentech have each conducted extensive preclinical testingof different forms of TRAIL/Apo2L. TRAIL/A...e cells to destroythemselves through apoptosis. In preclinical research, TRAIL/Apo2L has beenshown to cause a wide variety of tumor cells to undergo apoptosis whil...

Vion Demonstrates Readiness Of First Tumor-Targeting Salmonella For Human Testing Against Solid Tumors

..., Ph.D. and Li-mou Zheng, Ph.D. also reported new preclinical data showing the safety of VNP20009 in non-human primate models. Previous studies in mice have demonstrated that VNP20009 is more than 10,000 times less toxic than the wild-type Salmonella strain from which it is developed. Additionally, the studies ...

Researchers: 'Exciting' Discovery Might Improve Cancer Treatment

...reatment strategy that isbeing explored further in preclinical studies and should be available topatients within the year," Cusack said. "These findings provide new insight intowhy many cancer cells frequently don't die when exposed to chemotherapy. Theapproach demonstrates a successful means of how we might ove...

Immunex And Wyeth-Ayerst Laboratories Advance Enbrel Into Phase II/III Clinical Trial For Chronic Heart Failure

...e results of the study,and additional clinical and preclinical data associating elevated TNF levelswith chronic heart failure, the two companies have elected to proceed to a PhaseII/III multicenter trial. "We are pleased that the results of the multidose Phase I study supportedmoving into a Phase II/III multice...

Protestors Are Up In Arms Over Experiments That Give Chimps AIDS

...c HIV model in a chimp,"says Alan Schultz, head of preclinical research in the AIDS vaccine programme ofthe National Institute of Allergy and Infectious Diseases (NIAID) nearWashington DC. "The bad news is that to do meaningful vaccine experiments, wewill have to put chimps' lives at risk." The NIAID is ...

Allelix drug increases bone density and content in women with osteoporosis

...t at the mid and high doses after 12 months. "Our preclinical andclinical data suggest that the observed decreas...blasts to stimulate new boneformation. Additional preclinical studies have demonstrated this new bone is ofnormal architecture and strength. Postmenopausal osteop...

Chiron Discovers Significant Hepatitis C Binding Mechanism; Data Indicates CD81 Protein May Be A Virus Receptor

... high affinity to selected human cell types. In a preclinical vaccinemodel, administration of these envelope proteins resulted in protection from HCV challenges and correlated with the presence of antibodies that inhibited the binding of E2 to human cells. Confirmation ofvirus binding to CD81 was established u...

Antisense Therapy Prevents Burkitt's Lymphoma In Mice

...DNA Vectors," he and hiscoauthors describe various preclinical and clinical studies in the United Statesand other countries. In the book's preface, Dr. Wickstrom asserts that "cloning andsequencing pathogenic genes in the past two decades has made possible a directgenetic approach to the treatment of di...

Interleukin-12 Helps Control Mycobacterium Avium Infection

...ellulare. "This is an excellent example of how a preclinical study can provide a model fordesigning a clinical trial," says Anthony S. Fauci, M.D., director of NIAID. "It's very difficult to treat this infection in AIDS patients," comments Dr.Sher. Often patients have to be treated with three or four differen...

U.S. Scientists Honored For Lifetime Contributions In Hepatitis Research

... hepatitis E vaccine that is now in preclinical studies. Drs. Purcell and Gerin continue to collaborate on studies of mutual interest: testing a candidate hepatitis B vaccine in China; discovery of a new strain of hepati...

1 2 3 4 5 6

(Date:5/22/2013)... 22, 2013 Cedars-Sinai Heart Institute is honoring ... pioneer in modern mitral heart valve repair, Alain ... Corday, MD, International Prize in Heart Research. The ... recognize physicians and scientists conducting groundbreaking research, or ... medicine. , Carpentier is a leading ...
(Date:5/22/2013)... A new study provides neurobiological evidence for ... in people with insomnia, which may have implications ... , "Insomnia has been consistently identified as a ... Franzen, PhD, an assistant professor of psychiatry at ... in the brain circuitry underlying emotion regulation may ...
(Date:5/22/2013)... May 22, 2013 Digital Advertising Agency, ... behalf of its social media management client, Primal ... year's supply of the all-natural organic deodorant. The contest ... of the rapidly-growing start-up deodorant company based in Tampa, ... contest or sweepstakes on a Facebook page is a ...
(Date:5/22/2013)... (PRWEB) May 22, 2013 DiscountFurnaceFilter.com ... quality merchandise ranging from furnace filters, dehumidifiers, fans, ... is excited to add Stadler Form's product line ... summer product line (fans, aroma diffusers and dehumidifiers) ... Form’s Otto Fan is the perfect combination of ...
(Date:5/22/2013)... York, NY and Troy, NY (PRWEB) May 22, ... Medicine at Mount Sinai and Rensselaer Polytechnic Institute ... educational programs, research, and development of new diagnostic ... alliance was commemorated in a signing ceremony on ... initiative to use their expertise—Rensselaer’s in engineering and ...
Breaking Medicine News(10 mins):Health News:Heart valve repair innovator receives Cedars-Sinai Heart Institute's Corday Prize in Heart Research 2Health News:Study shows that insomnia may cause dysfunction in emotional brain circuitry 2Health News:Social Media Management Firm, 21Digital, Launches National Facebook Sweepstakes for Client, Primal Pit Paste 2Health News:DiscountFurnaceFilter.com Now Offers Stadler Form Products - Providing Solutions to All Your Summer Needs 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 2Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 3Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 4Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 5Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 6Health News:Icahn School of Medicine at Mount Sinai and Rensselaer Polytechnic Institute Announce Academic Collaboration 7
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition