Tag: "pregnancy" at biology news

New device detects fetal brain response to light: May help prevent brain damage

...s have shown that maternal hypertension, diabetes, pregnancy with two or more babies at once, and many other co...physiological factors that may influence a healthy pregnancy outcome, it ultimately could be used in a variety of clinical tests, the researchers say....

New UNC study suggests multivitamin use during pregnancy cuts childhood tumor risk

...stoma suggests women who take multivitamins during pregnancy can cut their children's risk of the tumor by 30 p...with earlier studies indicating vitamin use during pregnancy seems to help protect against childhood leukemias and brain tumors. A report on the study, conducte...

Pregnancy hormone induces healthy blood vessels, Magee-Womens Research Institute scientists report

PITTSBURGH, Aug. 22 The pregnancy hormone relaxin induces a healthy physiological re...ens to the cardiovascular and renal systems during pregnancy is in many respects the antithesis of changes associated with aging," continued Dr. Conrad, who is a...

Smoking decreases men's chances of fatherhood by IVF and ICSI

... The chances of the whole procedure failing and no pregnancy occurring was two to three times higher in smoking men compared with non-smokers. Smoking probably has an adverse effect during the fertilisation procedure, but, in addition, smoking damages the DNA in sperm and this may hamper the development of th...

PGD could save women from the agony of repeated miscarriages

... (IF). She and her colleagues had achieved normal pregnancy rates and a decreased risk of miscarriage in women...yos to the women, the researchers achieved similar pregnancy rates in all three groups (34.3% in the RM group, 32.4% in the IF group and 29% in the control group...

Multiple births - their risks and how to prevent them

...n reported without due observation of the multiple pregnancy rates and other problems But times were changing, ...eginning to realise that the incidence of multiple pregnancy must be reduced. To maintain efficacy we need to make a better selection of viable embryos and to i...

ICSI: Is it really safe?

...For many couples who otherwise could not achieve a pregnancy the slight increase in risk associated with these techniques will be acceptable." * ICSI intracycloplasmic sperm injection: process by which an egg is fertilised by the injection of a single sperm ** Hansen et al, NEJM 346, 725-730. *** Bonduelle et...

Semen makes you happy

...of New York who led the team. "Clearly an unwanted pregnancy or a sexually transmitted disease would more than offset any advantageous psychological effects of semen." His team divided 293 female students into groups depending on how often their partners wore condoms, and assessed their happiness using the Bec...

Preeclampsia linked with higher risk of preterm delivery

...ONTO, June 4 Every six minutes, a woman dies of a pregnancy complication called preeclampsia nine women an ho...egnancy. Dr. Lain and her colleagues also compared pregnancy outcomes among women who had preeclampsia early or late in a previous pregnancy, as well as among wo...

Even mild vitamin C deficiency may have negative effect on vascular function

...ONTO, June 4 Every six minutes, a woman dies of a pregnancy complication called preeclampsia nine women an ho... despite a natural physiologic change initiated by pregnancy that typically increases blood vessel elasticity, which in turn affects blood pressure. While resear...

Preeclampsia linked with higher risk of preterm delivery and later-life vascular disease

...ONTO, June 3 Every six minutes, a woman dies of a pregnancy complication called preeclampsia nine women an ho...nt women. Investigators found that having a normal pregnancy is associated with a positive long-term effect on blood vessel behavior that is not present in women...

The pathway to anxiety begins early in life

...omparable time in humans is the third trimester of pregnancy and the first two to three years of life. The study, led by Dr. Rene Hen, associate professor of pharmacology (in psychiatry and in the Center for Neurobiology and Behavior), focused on a serotonin receptor gene. The researchers manipulated...

Vitamin C transporter gene discovery in mice

...emonstrated that mice deprived of vitamin C during pregnancy and birth died almost immediately after birth from bleeding in the brain and respiratory failure. In humans, intracerebral hemorrhage, lung complications and respiratory failure are frequent causes of serious morbidity and death in premature infants...

Stanford researchers shine light on new genes involved in multiple sclerosis

...reatment. In the past, people have found that both pregnancy and allergy can prevent MS, he said, but nobody understood why. Among the genes that were overexpressed was a histamine receptor and proteins associated with pregnancy. These results could lead to the regular use of antihistamines to treat MS. "It su...

Scientists discover gene in human egg that may be necessary for female fertility

...ble that researchers may one day be able to induce pregnancy by injecting human Mater protein into the egg cells of these women before conception....

New research shows women's fertility starts declining from late 20s and mens from late 30s

... not mean a lower overall probability of achieving pregnancy if they delayed trying to become pregnant until th...e age, women aged 19-26 had around a 50% chance of pregnancy in any one menstrual cycle. This fell to around 40% for women aged 27 to 34. For women aged 35-39 i...

Of 101 neonates at a New Jersey hospital, 40 percent test positive for drugs of abuse

...ty of serious medical problems to the fetus during pregnancy and after delivery. For this reason the investigators support more funding for rapid-screening technology for use with infants. By knowing the status of these infants early, neonatologists and pediatricians can begin effective medical treatment witho...

Ultrasound cleans ceramic filters: Could aid water treatment

... fetal ultrasound tests that women undergo during pregnancy employ much higher frequencies -- on the order of 10 megahertz, or 10 million vibrations per second. But that doesn't mean a 20 kilohertz probe is less powerful, Weavers...

CDC MMWR: Fetal Alcohol Syndrome and Cutaneous Anthrax in a Lab Worker

...CDC reports that rates of frequent drinking during pregnancy remain high. Dr. Floyd will discuss Fetal Alcohol Syndrome, one of the most prevalent developmental disabilities affecting children. Drs. Rosenstein and Page will discuss a case of cutaneous anthrax in a Texas lab worker. The lab worker may have b...

Labor-inducing folklore alive and well among pregnant women

...cal advances in obstetrics, old wives' tales about pregnancy and labor still run rampant, e...est that a woman with a normal pregnancy can do is to just wait, said study author Jonathan Schaffir,...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker