Tag: "procedures" at biology news

Urban Ecology Study Watches Birds On The Web

...ey should first learn about surveyrequirements and procedures at the website and call Hostetler at 965-5841 toreceive a transect assignment....

Bugs Can Ward Off The 'Bends'

...bends even if they meticulously follow slow ascent procedures and take repeateddecompression stops. At such extreme depths, air becomes so dense that it can'tbe breathed-so divers breathe oxygen mixed with helium or hydrogen. Susan Kayar and her colleagues at the Naval Medical Research Center inBethesda...

DFG releases statement on possibilities and limitations of genetic diagnosis

...esearch into the human genome and novel diagnostic procedures for the firsttime offer the possibility to diagnos... from human genome research differsfrom diagnostic procedures commonly used in medicine for clarifying manifest diseases. Suchpredictive tests will not be capable...

AAAS study calls for federal funding for stem cell research but sees no need for new oversight mechanisms

...research, covering suchissues as public education, procedures for stem cell isolation, human subjectsprotection ...llected by using embryos remainingfrom infertility procedures after the embryo's progenitors have decided they donot wish to preserve them and have given full and...

LSU Ag Center researchers look for better ways to assess pollution in Tangipahoa River

...ates, researchers are trying to modify the testing procedures toimprove their ability to accurately measure potential problems and identifytheir sources in sub-tropical Louisiana. The Ag Center research centers around E. coli, bacteria that naturally occurin human and animal feces. "There are many pathoge...

Counting elephants by monitoring sounds

...esdropping on the sounds they make. New monitoring procedures will be tested in the Central African Republic,beginning in March 2000, and in Ghana in May 2000 before expanding to otherregions of the continent. "Acoustic monitoring may give us crucial information on the elephants aboutwhich we know almost nothin...

Key progress by Weizmann scientists in the race to unravel ribosomal structure

...res is closer than ever before. Their approach and procedures have recently beenrepeated by a growing contingent of international researchers - all racing to elucidate the mystery ofribosomal functioning. According to Yonath, this understanding should pave the way to improvedantibiotics, targeting bacterial age...

'Frozen pictures' allow far-reaching glimpse into the cells protein factory

...res is closer than ever before. Their approach and procedures have recently been repeated by a growing contingent of international researchers - all racing to elucidate the mystery of ribosomal functioning (Science, Vol. 285, p. 2084, 2095 and 2133;Nature, Vol. 400, p. 811, 833 und 841). According to Yonath, th...

Millenium bug found by CSIRO scientists

...fic name cannot be made public until international procedures for scientific naming are complete, but both its scientific and common names will be the "Millennium Bug". The "Millennium Bug" belongs to a new genus of the family Veliidae (small water striders) that scientists Mr Tom Weir of CSIRO Entomology and D...

Common algae can be valuable source of hydrogen fuel

...ld rise significantly without elaborate and costly procedures until the UC Berkeley and NREL teams made this discovery. The breakthrough, Melis said, was discovering what he calls a "molecular switch." This is a process by which the cell's usual photosynthetic apparatus can be turned off at will, and the cell...

Smoking during pregnancy found to increase risk of cleft lip and palate

...0 cases of cleft lip and palate repair and related procedures are seen at the U-M each year. The U-M's multidisciplinary program is one of the largest and oldest in the nation. Besides plastic and reconstructive surgeons Buchman and Chung, the U-M Craniofacial Anomalies Program includes 47 specialists and heal...

A big whoop! Crane chicks will hatch on-line: Go to whoopers.USGS.gov

...ographs and explanations of the innovative rearing procedures used by scientists, veterinarians, and technicians. A new colony of whooping cranes is being established in Florida from cranes raised by these procedures. In March, for the first time ever, one of the adult cranes raised from a chick by the U.S. Geo...

At the waters edge -- Managing riparian forests

...lloff, nearly 50 experts describe state-of-the-art procedures for managing forested riparian areas. The publication also provides managers and policy makers with tools to develop site specific guidelines for addressing eastern riparian landscapes characterized by fragmented ecosystems, fragmented ownership, an...

GM seed may be more widespread than we think

...he solution lies in internationally agreed testing procedures and limits on contamination. Smith thinks a 01 per cent limit should be set for accidental contamination. "You can't offer 0 per cent, because it's not scientifically feasible or defensible," he says. But such limits would raise another dilemma-wh...

Ney honored for fish research

...ion statistics. Ney formulated these concepts and procedures in a widely cited (1990) monograph, Trophic Economics in Fisheries: Assessment of Supply-Demand Relationships Between Predators and Prey. With his current generation of students, he is putting these concepts into practice to develop a protocol for op...

Virtual reality tool quantifies physics of a doctor's touch

...w physicians in one of the most formidable medical procedures they have to learn -- intubation. "Intubation is a very touchy procedure," Billittier said. "It involves putting a plastic tube into a patient's airway or windpipe when that patient may not be breathing or may be in shock." He pointed out that medi...

Genetic cause of lymphedema discovered by University of Pittsburgh researchers reported in Nature Genetics

...y result from infection, injury or common surgical procedures such as those for cancer in which lymph nodes are removed. Lymphedema can lead to infection, pain, severe disability or sometimes cancer. Current treatments involve applying pressure to drain the lymph fluid. An intricate series of fine tubes and n...

UI researcher validates underpinnings of scientific theory

...id, and not skewed by taxonomic error. We put the procedures of taxic paleobiology to about as rigorous a test as is possible, and the research program is basically validated," Adrain says....

Research changes surface mine reclamation practices, policy

...hes the biology, economics, engineering, and legal procedures for restoring productive forests on thousands of a... in the Appalachian region have developed specific procedures or regulations based on his research, with the outcome of thousands of acres of disturbed forest lan...

Researchers develop new method for preventing hip dysplasia in dogs

...y needs to be anesthesized once, and both surgical procedures are in the same area of the body. The incision for... There are at least two other corrective surgical procedures for hip dysplasia now used. One, called a Triple Pelvic Osteotomy, was adapted from a technique used...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid