Tag: "projected" at biology news

Can carbon sequestration solve global warming?

...oxide is injected into coal seams, and discuss the projected storage capacity of coal seams. White will detail some of the technological obstacles to performing sequestration of carbon dioxide in deep unmineable coal beds, as well as parallel efforts to identify and recover the methane gas that is found in som...

Smaller households fuel global housing boom and threaten biodiversity, study finds

...ation growth, reduction in household size alone is projected to add 233 million households to hotspot countries between 2000 and 2015,'' Daily said - a trend that could have a particularly damaging effect in biologically sensitive ares such as the Wolong Nature Reserve in China, where the growth in new homes h...

Survey of Chesapeake Bay watershed residents may save the bay

...ith the population of the Chesapeake Bay watershed projected to increase by more than one million people during the next 15 years, efforts to educate each citizen about their impact on the bay is becoming more critical. To address this issue, the Conservation Management Institute of Virginia Tech conducted a s...

Study employs backyard scientists to document global warming impact

...ificance lies in its foreboding. Global warming is projected to increase dramatically in coming years. While spring arriving early seems in itself innocuous, Hall said no one knows right now how these changes will affect the complex orchestration of the environment. "If temperatures are changing and wildlife ...

'Scientific balancing act' dominates AAAS top ten list of science policy stories for 2002

... segments of the nation's R&D enterprise. With the projected completion of the doubling of the NIH budget in FY 2003, the Institutes, which fund mainly medical and life science research, will comprise 50 percent of federal funding for nondefense R&D and 56 percent of the government's total support for basic re...

Shifts in rice farming practices in China reduce greenhouse gas methane

... limited data points." Demand for rice in Asia is projected to increase by 70 percent over the next 30 years, and agriculture currently accounts for about 86 percent of total water consumption in Asia, according to a recent report from the International Rice Research Institute. Changes to management practices...

Increase in rainfall variability related to global climate change

... that increased rainfall variability combined with projected higher temperatures and decreased rainfall amounts, may lead to even greater impacts on ecosystems than previously anticipated." In this study of how grasslands respond to more variation in rainfall patterns, the scientists hoped to better understan...

K-State researchers study response of prairie ecosystem

... increased rainfall variability when combined with projected higher temperatures and decreased rainfall amounts may lead to even greater impacts on ecosystems than previously anticipated. "This is a phenomenon of global importance, not just Kansas," Knapp said. "An increase in precipitation extremes is likely ...

Researchers discover gene that controls ability to learn fear

...teral nucleus but also in a number of regions that projected into the lateral nucleus was interesting because it suggested that a whole circuit was involved," said Kandel. Shumyatsky next showed that GRP is expressed by excitatory principal neurons and that its receptor, GRPR, is expressed by inhibitory intern...

2,000+ brown recluse spiders in a Kansas home inflict no bites in the occupants, UCR study notes

...uate education to nearly 16,000 students and has a projected enrollment of 21,000 students by 2010. It is the fastest growing and most ethnically diverse campus of the preeminent ten-campus University of California system, the largest public research university system in the world. The picturesque 1,200-acre...

Darwin Correspondence project receives Queen's Anniversary Prize

...ughout his life. The project has published 12 of a projected 32-volume set of Darwin's letters, The Correspondence of Charles Darwin. Volume 13 will be published next month. The letters provide a good historical view of the way the scientist's ideas took shape as well as the years he spent traveling on HMS ...

Brain's method of creating mental images differs with the source of cues received

...and forefinger into the device to "feel" an object projected onto a computer monitor. Through the devices, they see and feel the virtual object. "We found that when subjects grasped an object that felt 54 millimeters thick but looked as if it were 56 millimeters thick, their brains interpreted the object as be...

Life expectancy following diagnosis of Alzheimers disease depends on age at diagnosis

...in survival after diagnosis of the disease. "It is projected that in the next 50 years, the prevalence of Alzheimer's disease will quadruple with approximately 1 in 45 Americans living with the disease. Information on survival following diagnosis is important not only for predicting future prevalence of the di...

Scientists tackle the question: 'What will it really take to stop global warming?'

...70 parts per million over the last century, and is projected to pass 550 ppm this century. Given that 85% of the world's energy is derived from carbon dioxide-emitting fossil fuel, climate models and data indicate that the earth's temperature could climb 1.5 to 4.5 degrees Celsius (3 to 8 degrees Fahrenheit) ...

Scientists identify role of important cancer protein

...cientists first crystallized the complex, and then projected very bright x-rays produced by the NSLS onto the crystal. By looking at how the x-rays scattered off the crystal, the scientists measured a pattern of points with varying intensities, called a diffraction pattern, which represents a map of the atomic...

Sandia-aided method to heal wounded and diseased achieves US government acceptance

...lso is being tested for use by the elderly, and is projected available for home use in 2004. The product - called the Numobag after its creator and distributor, Numotech Inc. of Northridge, Calif. - was made commercially viable with the aid of inexpensive sensors and safety features developed at Sandia Nationa...

Rice, Brookhaven physicists decode initial stage of cell fusion

...cks of membranes made of phospholipids. Then, they projected x-rays produced by the NSLS toward the crystals. By looking at how the x-rays scattered off the crystals, Huang and Yang were able to create diffraction patterns, maps of the atomic structure of the phospholipid layers in the membranes. By dehydratin...

Darwin's letters being sent to Galapagos Islands as part of Darwin Correspondence Project

...arwin Correspondence Project has published 12 of a projected 32-volume set of Darwin's letters, The Correspondence of Charles Darwin, and is sending those published volumes back to the Charles Darwin Research Station in the Galapagos. Darwin's letters provide a good historical view of the way the scientist's...

Finding the right path

...) will kill two million people this year, with the projected number of new infections over the next twenty years reaching a billion. A rapidly moving, constantly mutating disease, TB's effects are made worse by its ability to quickly react to new drug treatments, becoming resistant to antibiotics. Searching ...

New insight into how eyes become wired to the brain discovered by Salk, UT Southwestern scientists

...d vertical dimensions that compose images that are projected onto the retina. Using the Eph mutant mice provided by Henkemeyer, the Salk Institute researchers, including O'Leary and two of his postdoctoral fellows, Drs. Robert Hindges and Todd McLaughlin, who were co-principal investigators, showed that the in...

1 2 3 4 5 6 7

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills