Tag: "protects" at biology news

Vioxx in high doses causes hypertension

...they don't inhibit the related COX-1 enzyme, which protects the stomach lining. Therefore they don't irritate the stomach as much as NSAIDs that block both enzymes. "They cause fewer ulcers," explained the study's lead author, Marie R. Griffin, M.D., MPH, professor of Preventive Medicine and Medicine. "That's...

Tracing a killer's path in Lou Gehrig's disease

...enzyme superoxide dismutase (SOD1), which normally protects cells from harmful reactive oxygen species. However, about 3% of people with ALS have a mutant form of the enzyme. Don Cleveland and his colleagues conducted experiments in mice showing that the mutant SOD1 protein selectively migrates to the mitocho...

JCI table of contents, 1 July 2004

...LE: Absence of platelet-activating factor receptor protects mice from osteoporosis following ovariectomy AUTHOR CONTACT: Satoshi Ishii The University of Tokyo, Bunkyo, Tokyo, Japan. Phone: 81-3-5802-2925; Fax: 81-3-3813-8732; Email: mame@m.u-tokyo.ac.jp View the PDF of this article at: https://www.the-jci...

$5 million grant funds partnership, studies of minority-based issues in reproductive health

...hat in some cases predisposes them and, in others, protects them, from reproductive morbidities. For example, previous studies have shown that higher levels of sex steroids in African-Americans predispose them to a number of reproductive conditions including higher prevalence of polycystic ovary syndrome, ben...

Four tourist destinations named best worldwide

...s done well, it provides economic opportunity, and protects natural environments and cultural heritage," said Keith Bellows, editor of National Geographic Traveler magazine. "My hope is that our readers indeed all travelers will support businesses and organizations which promote the ideals of sustainable to...

LARGE protein can overcome defects in some types of muscular dystrophy

...atrix, providing essential structural support that protects the muscle membrane from contraction-induced damag...ween alpha-dystroglycan and the surrounding matrix protects against this stress. According to Campbell, in patients with muscular dystrophy the absence of this ...

VIB presents its annual results at BIO2004 in San Francisco

...cines. To bring these applications into being, VIB protects its findings via patents: in 2003, 30 discoveries were sufficiently new and inventive to warrant patent applications. At the same time, VIB entered into nearly 50 collaborative agreements with business and industry. In addition, VIB was the catalyst ...

RNAi delivery system crosses blood-brain barrier to target brain cancer

...ules. Once inside the compartment that houses and protects the brain, a second set of liposome-embedded antibodies seeks out the human insulin receptor found in the membranes of brain cancer cells. The insulin receptor antibody latches on to the tumor's insulin receptors. The liposome, and its contents, uses...

The search for a safer smallpox vaccine: New data released on promising candidate

... has demonstrated that the vaccine, given to mice, protects against a virus related to smallpox that has been aerosolized. According to Buller, this closely models how smallpox could be delivered during a bioterrorist attack. Buller and his colleagues, working in accordance with VaxGen and the National Insti...

Study may improve survival of transplanted livers

...the transplant, the study indicated. "Nitric oxide protects the liver during the reperfusion phase, after ischemia has occurred, and this means we can intervene in a meaningful way," said Lemasters. "We can treat after disease onset." Because it reacts rapidly with oxygen, nitric oxide can cause damage to the...

Cancer drug resistance research leads to possible therapeutic target for Alzheimer's disease

...cells, they are more vulnerable to damage. Myelin protects them by sheathing their axons--threadlike extensions of the nerve cells--in alternating layers of protein and fat. A new model of human brain aging (Neurobiology of Aging, January 2003) postulates that mid-life breakdown of myelin could be a possibl...

Stem cells more vulnerable to toxic chemotherapy when protective molecule is disabled

...led BCRP (breast cancer resistance protein), which protects HSCs from excessive levels of heme. In conditions of low oxygen, cells tend to compensate by making more heme molecules. But the cells must also protect themselves from excess heme by making BCRP, which is capable of binding to these oxygen-carrying...

Moderate alcohol consumption increases plasma levels of a protective hormone

...iological studies show that moderate drinking also protects against diabetes mellitus type II," he said....

Study examines future of species extinction, conservation

...nt to that environmental pressure and, in a sense, protects it from future degradation. "One important message is that if we're going to understand the consequences of extinction, we need to pay attention to order," says Bradley Cardinale, a UW-Madison postdoctoral fellow and also co-author of the recent pape...

Protein keeps cold fish from becoming frozen flounder, new study shows

...ion, which in combination with blood solutes, only protects the fish down to -1.5 degrees Celsius. "This finally explains the 'critical gap' of 0.4 degrees," says Dr. Davies, a Queen's Canada Research Chair in Protein Engineering. "The winter flounder has been studied extensively by a number of laboratories...

Experimental smallpox DNA vaccine protects primates from lethal monkeypox

...er, epidemiological studies have shown that Dryvax protects humans against both smallpox and monkeypox. All the orthopoxviruses--vaccinia, monkeypox, and variola--are highly similar in the majority of their nearly 200 proteins, which partially accounts for the cross-protection among these viruses. However,...

Hopkins scientists overcome main obstacle to making tons of short, drug-like proteins

...the new process, a first chemical step temporarily protects one reactive side of the exposed nitrogen atom of the amino acid, and a second step adds the methyl group to the nitrogen's other open spot. The final step uses ultraviolet light to remove the protecting group added in step one. The result is a sing...

New studies show Curves Program raises metabolic rate in overweight and sedentary women

...low carb / low fat diet actually increases REE and protects muscle, which leads to the burning of fat stores and the ability to eat a healthy amount of food." Heavin holds a degree in Health and Nutrition Counseling and is the author of The New York Times Best-Sellers Curves: Permanent Results Without Permane...

Sick Kids researchers look at viral triggers for multiple sclerosis in children

... of myelin, the protein coating that surrounds and protects nerve fibres (axons). MS is believed to involve a complex interplay between environmental triggers (such as infections), genetic predisposition, and an abnormal autoimmune response. At least five per cent of all MS patients experience the onset of th...

Study is another step in determining if curry can protect against Alzheimer's

..., could be an effective enhancer of an enzyme that protects the brain against oxidative conditions. This research is an important first step in determining whether curry could be preventive agent against acute neurodegenerative conditions, or reducing the progression of chronic and age associated neurodegene...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument