Tag: "rates" at biology news

Common therapy for HIV associated with cervical abnormality regression

...e status afforded by HAART improves the regression rates of SIL. Linda Ahdieh-Grant, Ph.D., of Johns Hopki...y of Washington in Seattle, further noted that the rates of regression in HIV-infected women receiving HAART remained lower than the rates seen in HIV-negati...

Heat and exercise alone may not determine how much we sweat

...ternal and skin temperatures, which increase sweat rates and skin blood flow. How much we sweat can also depend on nonthermal factors such as exercise, baroreceptor loading status, and body fluid status. During exercise, heart rate and mean arterial pressure (MAP) are elevated via a combination of central...

Impact of Earth's rising atmospheric carbon dioxide found in world oceans

... as seawater CO 2 levels rise the skeletal growth rates of calcareous plankton will be reduced as a result...hor. Recent studies have shown that calcification rates can drop by as much as 25 to 45 percent at CO 2 levels equivalent to atmospheric concentrations of ...

Carnivore extinction risk determined more by biology than human population density, says study

...n the IUCN-World Conservation Union Red List which rates how likely a species is to become extinct, ranked in six categories from 'Least Concern' to 'Critically Endangered'. The research was funded by the Natural Environment Research Council, Conservation International's Center for Applied Biodiversity Sci...

Tips from the Journals of the American Society for Microbiology

...n immune system function with age. High mortality rates in humans over the age of sixty-five continue to challenge vaccinologists to explore new means of improving immune responses to the flu virus vaccine. "During influenza epidemics, the rate of hospitalization in the elderly is high, with up t...

Funding to commercialize technologies of UC San Diego engineers tops $1.2 million

... measure emissions and performance oscillations at rates needed for rapid feedback control of these devices (e.g., 500 Hz and above), and because the sending and receiving electronics can be mounted at some distance from the high temperature process, only a small optical access is needed for the fiber-opti...

New pulmonary hypertension guideline challenges use of common medication

...gnant due to the high maternal and fetal mortality rates associated with the disease. "There are many misconceptions about PAH, since it is relatively uncommon, leading to inappropriate reliance on some tests and treatments. In addition, symptoms of PAH are similar to other respiratory diseases, such as...

Experiment station researcher looking for missing links in corn

... his greatest worry is Africa, because of its high rates of population, little application of improved technology and escalating food deficits. Borlaug and the International Center for Wheat and Maize Improvement are promoting the development and adoption of Quality Protein Maize in developing countries ar...

'Weed from hell' found in Texas

...uch as Remedy. Use one quart per acre with labeled rates of nonionic surfactant in 40 gallons/acre of water, Redmon said. By the time the task force learned about the Jasper infestation, it was too late in the season to follow these recommendations, said Dr. Paul Baumann, Extension weed control specialist...

Animal research suggests plant estrogens in soy do not increase breast cancer risk

...hat typically consume diets high in soy have lower rates of breast cancer. On the other hand, some studies have shown that soy isoflavones can stimulate breast cancer cells grown in the laboratory. "Evidence from observational studies in women indicates that soy intake may help prevent breast cancer," sai...

Milk consumption and calcium intake associated with lower colorectal cancer risk

.... Researchers have hypothesized that the different rates of colorectal cancer incidence in various countries may be related to diet. Although high calcium intake has been shown to inhibit colon cancer in animal experiments, these effects have not been seen consistently in human epidemiologic studies. To be...

Croatian skeletons reveal changing status of cancer in Europe across the centuries

Cancer incidence rates in the developed world are increasing each year and developing countries are also now showing an increased incidence of the disease. But how much were our ancestors affected by the disease? Dr. Mario Slaus of the Croatian Academy of Sciences and Arts...

Old is young, study finds

... them to assess the significance of differences in rates of molar wear. In the study, they defined "old" to be at least double the age of reproductive maturation, which is also the time when the third molars typically erupt. "While the age of reproductive maturation may have varied in early human groups, i...

Vacuum assisted deliveries are safe alternative to forceps

...as safe as forceps.Furthermore, the relatively low rates of fatal complications among vacuumdeliveries argu...rumental vaginal deliveries may help to reduce the rates ofcaesarean section. Although delivery by vacuum extraction does have risks,it remains a safe altern...

Highlights of the July Journal of the American Dietetic Association

...or excess weight at age 5 had significantly higher rates of "dietary restraint" by age 9 because of trying to maintain or lose weight, weight concern, body dissatisfaction and a tendency to overeat immediately after a meal in the absence of hunger. "Children's participation, parental involvement and knowl...

Basic RNA enzyme research promises single-molecule biosensors

... quickly the ribozyme switched forms and how these rates changed when various parts of the molecule were altered. With the addition of mathematical simulations, the researchers also could investigate how changing parts of the ribozyme molecule affected its ability to catalyze chemical reactions. They were...

RSV can increase the risk of asthma, UT Southwestern researchers find

...ing antibody significantly reduced hospitalization rates in high-risk infants. UT Southwestern researchers tested the medication on mice and demonstrated that the anti-RSV antibody not only prevented the acute severe form of bronchitis but also prevented the long-term complications of the disease. The find...

Germans must research the history of reproductive medicine during the Nazi era

...ge, which means that Germany has one of the higher rates of multiple births in Europe, because doctors have to transfer all the embryos they manage to create, regardless of the embryo's quality 40% of all ART births in Germany are multiple births, which carry risks for both the mother and the babies. Clo...

Hope Clinic of Emory Vaccine Center receives CDC contract

...icide gels resulted from the increase in incidence rates of HIV and AIDS among women and the need for a safe, effective, and acceptable female-controlled method of HIV prevention. In 1986, women accounted for 8 percent of AIDS cases in the United States, increasing to 26 percent in 2001. These new cases ...

Biologists ID defense mechanism of leading fungal pathogen

...da infections spread to the bloodstream, mortality rates climb as high as 50 percent. Candida's defense against NO relies on enzymes called flavohemoglobins. Gustin's research involved a test of three Candida genes -- CaYHB1, CaYHB4 and CaYHB5 -- that produce the enzymes. Gustin's research group created th...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker