Tag: "replacement" at biology news

Animal Studies Indicate Aging Brain Responsive To Estrogen

...for the many post-menopausal women now on estrogen replacement therapy,Williams said. "While most people are awa...sm to explainrecent findings that women on hormone replacement therapy, and with a familyhistory of Alzheimer's disease, are less likely than their untreated sibli...

UW Smogmobile Offers Cleaner, Safer Alternative To Gas Or Electric Cars

...s and electric cars (including the cost of battery replacement every two to three years). Despite the environmental and economic benefits of liquid nitrogen vehicles, Hertzberg realizes it will be difficult to attract the interest of an automotive industry and public already committed to gas- and electric-powere...

Menstrual Phase Linked To Ineffective Mammograms

...n hormones in the form of oral contraceptives or replacement therapy. Theanalysis showed a total of 1,898 women in study had never used hormones, 6,573 women werepast users and 416 were current users. A false-negative mammogram occurs when the x-ray is read as not suspiciousfor cancer when in fa...

Researchers To Investigate Years Before Menopause

...eir physicians in making choices about hormone replacement therapy." "This research would not be possibl...fects of hormones from birth control pills and replacement therapy are unknown. "Much of what we know about women's reproductive cycles came from the ...

Calcium Potentiates The Effect Of Estrogen And Calcitonin And Bone Mass

...menopausal women who use a combination of estrogen replacement and atleast 1200 mg calcium daily, rather than either treatment alone....

Good Ergonomics Is Good Economics

...all-processing time. Included in the redesign were replacement of an all-uppercase display with a mixed-case display and the addition of a highlighting feature for the listing selected by the directory assistant. Based on extensive before-and-after measurements, results showed a 600-ms reduction in average call ...

Duke Researchers Develop First Treatment For Rare Muscle Disease

...But for Pompe disease, previous attempts at enzyme replacement therapyfailed because the enzyme was not taken up by the muscle cells," Chen said. "Wecircumvented this problem by using the body's own system to get the enzymeinside muscle cells." Chen solved the problem by purifying a form of the enzyme t...

Wistar Scientist Invited To Speak On Regeneration At National Meeting Of American Association For The Advancement Of Science

...rcedtheir ears. Again, the holes closed with full replacement of the epidermis,dermis and cartilage, and with no evidence of scarring. "At first" explains Dr. Heber-Katz, "it wasn't clear if we had a model forstudying wound repair or regeneration, which is a rare form of wound healing inmammals. Since then, ho...

Researchers Investigate Years Before Menopause

...nd their physiciansin making choices about hormone replacement therapy. "This research would not be possi...he effectsof hormones from birth control pills and replacement therapy are unknown. The researchers include Wood; Kathleen O'Connor, post doctoral traine...

Biologists Map First Gene For Age-Related Hearing Loss In Mice

...in with normalhearing. The only difference was the replacement of the mutantAhl gene with the gene for normal hearing. Because the newcongenic strain had normal hearing, and the only differencebetween the two strains was a single stretch of Chromosome 10,that was further evidence of the location of the Ahl gene....

Transplanted Neurons Restore Function In Rats After Stroke

...lled conditions and storedfrozen, could be used as replacement therapy to reverse the deficits of stroke,"notes Virginia M.-Y. Lee, PhD, a professor of pathology and laboratory medicineat Penn and a coauthor on the study. Lee and Penn colleague John Q. Trojanowski, MD, PhD, also a professor ofpathology a...

UPMC Researchers Report On Gene Therapy Advances

...eviously scheduled jointreplacement. During joint replacement surgery, researchers remove joint liningand fluid and then examine them post-operatively to determine the success of thegene transfer. Osteoporosis, which involves increased bone fragility, has potential genetherapy treatment options as well. Dr. E...

Sex Differences In Heart Disease May Be Due To Enzyme That Breaks Down Fat

..."Another very interesting question is how estrogen replacement therapymight affect HDL and small dense LDL in post-menopausal women," he adds.Evidence is mounting that small, dense LDL particles are the "baddest of thebad" because they are most likely to clog the arteries, Hokanson says. Having apredominance of...

Wake Forest Study Shows Soy Containing A Key Ingredient Is What Lowers Cholesterol

... many of the same benefits as the standardestrogen replacement therapy, including lowering of cholesterol, reducing therisk of hardening of the arteries, and overall, improving the function ofarteries. Crouse said prior studies of the effects of soy on blood cholesterol inpeople had showed variable resu...

Soy Phytoestrogens Reduce Carotid Atherosclerosis As Much As Premarin

WINSTON-SALEM, NC -- Postmenopausal hormone replacement therapy markedlyreduces the occurrence of atherosc...se of stroke. The team found that hormone replacement therapy from soy protein withphytoestrogens provided equivalent stroke-prevention benefits to the st...

Soy Protein With Phytoestrogens Inhibit Atherosclerosis Progression As Well As Premarin

...ciation meeting in Santa Fe, N.M. Estrogen replacement therapy generally is thought to preventcardiovascu...es in plaque size." Both forms of estrogen replacement therapy were similar in their effectsin lowering total cholesterol, low density lipoproteins (LDL) a...

Novel Method Of Gene Replacement Reported By University Of Washington Researchers

...a modified virus to perform a novel method of gene replacement that may be animportant step toward overcoming obs...that thetechnical obstacles to efficient, targeted replacement of defective genes willeventually be overcome. The research was supported by grants from th...

Common Mutations Linked To Increased Risk Of Breast Cancer

...Slightly moreof the control subjects used estrogen replacement therapy, and each group hadsimilar levels of contraceptive use. "We had a pretty tight fit between the control and the experimentalgroup," Dr.Helzlsouer said, "but we can't be sure another risk factor isn'taffecting our results until researc...

First Evidence That Localized Arthritis Gene Therapy Heals Distant Diseased Joints

...rtificial joints during a medically required joint replacement surgery. These knuckles are being examined for evidence of gene therapy activity. The Pitt researchers have found evidence of gene expression in all patients tested thus far, and no adverse effects have been seen. For additional inf...

Biochemist Solves Riddle Of Collagen Stability

... medical researchers are studying whether collagen replacement therapy could alleviate some of the damage caused by arthritis. "In arthritis sufferers, the body's immune system is tricked into thinking its own collagen is a foreign entity that must be destroyed," Raines said. "That process might be triggered whe...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... New York, New York (PRWEB) May 22, 2013 ... for the nation’s first trial involving a da Vinci ... in the case, the family of a man who allegedly ... is seeking more than $8 million in damages from Intuitive ... watered down its physician training program for the da Vinci ...
(Date:5/22/2013)... IL (PRWEB) May 22, 2013 Nearly ... Veterans’ Appeals (BVA) in fiscal year 2012, with even ... themselves waiting longer for a decision as the agency ... Allsup, which provides veterans disability appeal services. ... of Veterans Affairs. , Although the BVA received 49,611 ...
(Date:5/22/2013)... is a gender gap when it comes to behavior ... does not appear to exist in children in Asia. ... of self-regulation than boys. Self-regulation is defined as children,s ... and persist on a task. It has been linked ... by Oregon State University researchers. , In three ...
(Date:5/22/2013)... 2013 Successful Therapy for Parents ... Psychotherapy in the Silver Lake community of Los ... as progression to existing Parents and Couples counseling ... parenting therapy has always been suggested, but now ... now specializes in all aspects of relationships ...
(Date:5/22/2013)... 2013 Diversity Focus and Handicap This ... The performance promotes awareness that physical disabilities do not ... performance will be held Friday, June 14th at 7:30 ... Tickets for Handicap This! can be purchased at ... the level to which their mind is handicap accessible. ...
Breaking Medicine News(10 mins):Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 2Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 3Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 4Health News:Veterans Disability Appeals See Fewer Decisions in FY2012, Reports Allsup 2Health News:'Boys will be boys' in US, but not in Asia 2Health News:'Boys will be boys' in US, but not in Asia 3Health News:Patricia O’Laughlin Psychotherapy of Los Angeles Now Seeing Adults, Teens and Young Children 2Health News:Handicap This! Comes to Marion, Iowa 2
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated