Tag: "result" at biology news

NSF awards 22 new projects for plant genome research

...ailed map of the tomato genome. The map that will result from this work will pave the way for development of improved varieties of tomato, and will also help scientists understand related plants, including potatoes, peppers, tobacco and coffee. A project led by Indiana University will study the genomes of...

NSF and AIBS sign cooperative agreement for NEON project office

...he causes and consequences of invasive species all result from complex interactions between human, natural and physical systems," said Elizabeth Blood, program director in NSF's division of biological infrastructure, which funded the award. "These systems change over time and cross all levels of biological...

New anti-inflammatory strategy for cancer therapy identified by UCSD researchers

...tered to tumor-bearing mice with normal NF-kB, the result was a rapid and robust induction of circulating TN...ed into the mice following the LPS challenge. The result was tumor growth. In their summary, the researchers said that sin...

Genetic modification of linseed produces healthier omega 3 and 6 fatty acids

...urated fatty acids (PUFA) in seed. The work is the result of an international collaboration between scientists at several research institutions in Germany (University of Hamburg, BASF Plant Science GmbH and Forschungszentrum Borstel), Rothamsted Research Station in the U.K., and Kansas State University in t...

Tips from the Journals of the American Society for Microbiology

...microbial activity in meat and fish increased as a result of treatment with the mixture and was further enhanced by the addition of lactic acid. "Oregano and cranberry, useful botanicals generally regarded as safe for food flavoring and as functional ingredients are known for thei...

Folic acid vitamin use by women reaches all-time high, March of Dimes survey finds

...these defects, and additional affected pregnancies result in miscarriage or stillbirth. To help prevent NTDs, the March of Dimes says, all women capable of becoming pregnant should consume a multivitamin containing at least 400 micrograms of folic acid every day beginning before pregnancy, as part...

JCI table of contents September 15, 2004

... and the clinical symptoms vary, but generally the result is profound vision loss, most often caused by the death of retinal neuronal through a form a cellular suicide called apoptosis. In many cases the vasculature in the retina also becomes atrophied. It remains uncertain, however, if the vasculature atr...

Hardy buoys: Texas A&M project predicts oil spill movements

...ill was headed south down the Texas coast, and the result was the saving of at least $250,000 in cleanup costs. "But the important thing is that state officials realized the true value of these buoys," Guinasso says. "We saved the time and effort of mounting a response in areas where it wasn't needed." The ...

TANGO: towards faster prognosis of Alzheimer's and Parkinson's diseases?

...Parkinson's disease, and mad cow disease - are the result of proteins that erroneously assume the wrong shape, causing them to stick to each other. This phenomenon is perceptible, but up to now it has been difficult to predict. Researchers from the Flanders Interuniversity Institute for Biotechnology (VIB) ...

AACR applauds NCI initiative on nanotechnology

To better understand the molecular steps that result in cancer and its spread, scientists and clinicians increasingly are turning to smaller and smaller probes that not only act as microscopic sentinels, but also as tools capable of interfering with these processes. For this reason, the American Associ...

Laboratory grows world record length carbon nanotube

...evelopment of longer length carbon nanotubes could result in nearly endless applications. Actually, the potential uses for long carbon nanotubes are probably limited only by our imagination." Long metallic carbon nanotubes can be used to create a bio/chemical sensor in one segment while the rest of the nan...

Can an old gene learn new tricks?

...ution of higher-order vertebrate organ systems can result from primitive developmental genetic programs that...evolution of higher vertebrate characteristics can result from the recycling or redeployment of 'old' genes in new parts of the embryo, rather than through mu...

ConocoPhillips & Conservation International launch 'Biodiversity Action Plan' in Venezuela

...s laid out in the Biodiversity Action Plan are the result of the biodiversity and socio-economic research from the AquaRAP and Threats and Opportunities Workshops. Both ConocoPhillips and Conservation International hope that the results of the AquaRAP and workshop not only promote improved resource manageme...

Lecture on ecology of infectious diseases

...nturies. Plague outbreaks in prairie dog colonies result in the death of nearly all prairie dogs in the colony, yet little is known about the factors that influence where and when plague epidemics will strike. Because of the close proximity of prairie dog colonies to human dwellings, concern is growing th...

Spontaneous mutation produces new MAO A/B knockout mouse

...r or lower than normal amounts of these isoenzymes result in irregular neurotransmitter levels, causing abnormal behavior. Realizing the connection between neurotransmitter levels and behavior, psychiatrists routinely use MAO A inhibitors as antidepressants and MAO B inhibitors for Parkinson's disease. By m...

New research suggests early diet may play key role in protecting against childhood leukaemia

...eterocyclic amines and nitroso-compounds which can result from eating certain processed foods. He has also shown that curcumin irreversibly inhibits the multiplication of leukaemia cells in cell culture. Nagabhusan says these results are confirmed in humans. Dr Marilyn Kwan of the University of California...

Two Virginia Tech energy-related inventions win R&D 100 awards

...re excited and invited a proposal," he says. The result was a $2 million National Petroleum Technology Program grant, awarded in 1998 to develop specific technology -- the first nationally funded project to develop fiber optic down-hole sensors. Chevron also funded the research. "And Virginia Tech's resea...

Snakehead in your inbox? Welcome to the nonindigenous Aquatic Species Alert System

...r drainage. Most nonindigenous introductions are a result of human activities since the European colonization of North America. This includes not only species that arrived from outside of North America, which are commonly referred to as exotics, but also species native to North America that have been introd...

Breaking new ground in germ cell guidance

...ind of competitive homeostasis, which might be the result of a shared uptake and dephosphorylation of a common substrate necessary for the survival of germ cells. In this model, too much Wun or Wun2 in somatic cells would deprive germ cells of the survival signal, causing them to die; too little Wun2 in the...

Story tips from the Department of Energy's Oak Ridge National Laboratory, September 2004

...ty introduced by the use of organic polymers could result in such future products as electronic paper, lumin...ore Arctic settings. Gas kicks, blowouts and fires result when workers penetrate pockets of gas hydrates. Another concern is the effect discharge of methane m...

1 2 3 4 5 6 7 8 9 10

(Date:8/27/2015)... ... 27, 2015 , ... Healthpointe is proud to welcome Dr. Ted Priebe, O.M.D., ... Licensed to practice Chinese Needle Therapy since 1983, Dr. Priebe specializes in the study ... also practices in Healthpointe’s La Mirada clinic and Garden Grove clinic. , ...
(Date:8/27/2015)... ... , ... More destinations and stores are becoming pet-friendly, making the family companion ... some tips to help your whole family travel safely and comfortably. , According to ... year. Amica is sharing the following tips from the American Society for the Prevention ...
(Date:8/27/2015)... , ... August 27, 2015 , ... Banc Intranets ... Clear System. The agreement will enable both Johnson City, Tenn.-based firms to work synergistically ... is a cloud-based safety product that caters to organizations in the financial, commercial and ...
(Date:8/27/2015)... , ... August 27, 2015 , ... ... high-performance blending all in one machine with the Nutri Ninja® Auto-iQ Pro Complete ... next-generation Auto-iQ™ Smooth Boost™ Technology that takes drink customization to a whole new ...
(Date:8/27/2015)... FL (PRWEB) , ... August 27, 2015 , ... Florida Hospital North Pinellas, located at ... Harbor in the Fall of 2016. The new facility will be located at US Highway ... , The property closed on August 18, and work on the project is slated to ...
Breaking Medicine News(10 mins):Health News:Qualified Medical Examiner and Acupuncturist Joins Healthpointe in Los Angeles 2Health News:Qualified Medical Examiner and Acupuncturist Joins Healthpointe in Los Angeles 3Health News:Amica Unleashes 5 Tips for Safe Traveling with Pets 2Health News:Banc Intranets Forms Strategic Marketing Partnership with All Clear System 2Health News:Banc Intranets Forms Strategic Marketing Partnership with All Clear System 3Health News:Banc Intranets Forms Strategic Marketing Partnership with All Clear System 4Health News:SharkNinja's Nutri Ninja® Auto-iQ™ Pro Complete Delivers Power And Versatility In A Compact Design 2Health News:SharkNinja's Nutri Ninja® Auto-iQ™ Pro Complete Delivers Power And Versatility In A Compact Design 3Health News:SharkNinja's Nutri Ninja® Auto-iQ™ Pro Complete Delivers Power And Versatility In A Compact Design 4Health News:Florida Hospital North Pinellas is Opening a New Free-Standing Emergency Room in Palm Harbor 2Health News:Florida Hospital North Pinellas is Opening a New Free-Standing Emergency Room in Palm Harbor 3
Other Tags
eadsannuallydeathsmultidisciplinarythicknessmischiefpoetprokaryoticsponsoredwebsinusendoscopicfragmentimpulsivityspatmattress