Tag: "reversal" at biology news

Scientists Sift Through Trash In Search Of Perfect Landfill

...ovesquite nicely toward oblivion. This study was a reversal of most landfill surveys, which take core samples frommaterial already buried. Ham says this study gave them controlled information atlandfills in Florida, Pennsylvania and Madison on 11 representative types oftrash. "By tracking what happens to the...

New Study Highlights Hazards On Hormone Disrupting Chemicals

... normal development, cause different degrees ofsex reversal andaffect behaviour. Around the world, numerous incidences have been reported ofhumans or wildlifehave been exposed to potential EDSs. For instance, in many parts of the world,including the BalticSea, it has been observed that gastropods develop impo...

Possible Human Ancestors In Spain 780,000 Years Ago

...reversal, took place about 780,000years ago. This reversal marks the boundary between the lower and middlePle... them,because we still have not found the polarity reversal for the Matuyama/Brunhesboundary. We did locate the boundary at Galeria, but all fossils and toolsf...

Bird Dads Suffer Infidelity But Bring Up Baby

..." Biologists study these unusual cases of sex-role reversal and conspicuouspolyandry not out of perverse curiosity, but to learn more about decision-makingamong the majority of animal species, explains Wrege, a senior researchassociate at Cornell. "In cases of bi-parental care and supposedly monogamous pair...

Hanson receives one of the first Keck Foundation awards for distinguished young scholars in medical research

...hey mightreveal other factors needed for fusion or reversal of this process. Hanson graduated magna cum laude from Yale University in 1985 with amajor in molecular biophysics and biochemistry. She then received medical anddoctoral degrees from Stanford University in 1993. She returned to Yale for apos...

Duke scientists reverse a rare form of muscular dystrophy in mice using gene therapy

...at to date they have only demonstrateda short-term reversal of symptoms in laboratory mice, and further experimentsare needed to determine if the approach could become practical for use inpeople. The study is part of a large, collaborative effort at Duke University tofind an effective treatment for P...

Blueberries: New thrills for those over the hill

... exciting finding from this study is the potential reversal of someage-related impairments in both memory and motor coordination, especially withblueberry supplements," said Molly Wagster, Ph.D., a Health ScientistAdministrator with the NIA's Neuroscience and Neurospsychology of Aging Program."For these anima...

Brain neurochemicals, not gender, tell a female to act like a female

...across all of the vertebrate groups, from sex role reversal to dynamic diversity in the sex differences found for parental care and aggressive competition." The study was supported, in part, by grants from the National Science Foundation. Logistical support was provided by the University of California Bodega...

UF researcher develops high blood pressure drug using gene therapy technique

...aterial is then known as antisense because it is a reversal of the DNA message, which scientists sometimes refer to as "sense." They then packaged the antisense into a solution that could be injected into the bloodstream. "The results look promising for a new way to treat hypertension with a drug that is ...

Advanced cell technology reports reversal

...ell Technology, Inc. today reported the successful reversal of the aging process in cells. The company's breakthrough may be the path to successful use of therapeutic cloning techniques to cure some of humankind's most intransigent age-related and degenerative diseases such as Parkinson's, Alzheimer's and dia...

Spring meeting press conferences

...e not yet demonstrated much success at broad-scale reversal of human disturbance, particularly in the most degraded (i.e. urban) environments. Those efforts that follow a cookbook approach or that simply focus on specific species enhancement (e.g. under the Endangered Species Act) hold little promise for long...

Discovery of fossil mollusks in Alaska links histories of Arctic Ocean and Isthmus of Panama

...of Panama approximately 3.6 million years ago to a reversal of water flow through the Bering Strait. Louie Ma... northerly one around 3.6 million years ago. This reversal in flow direction had been theorized by computer models of past ocean flow, and was thought to have ...

Researchers decipher fundamental signal for maleness

...es, found on Chromosome 9, are associated with sex reversal in children with normal Y chromosomes. Such children have a high risk of developing cancer in one or both gonads. The gene, called "doublesex" in the fly for its complementary roles in males and females, is also present in a wide range of multicellul...

Something's fishy with Columbia chinook: females carry male's genetic signature

... radiation as a possible cause of the apparent sex reversal but suggested environmental contaminants that mimic hormones or water temperature changes could be the culprits. The research by University of Idaho and Washington State University scientists in cooperation with the Pacific Northwest National Laborat...

How to build strong bones: Get milk, lose the booze

...rinking cessation does not result in a spontaneous reversal of alcohol-induced bone loss," said Turner. "This may mean that alcohol has an irreversible toxic effect on bone cells, or that alcohol interferes with the normal communication between bone cells which governs the delicate balance between how much b...

Penn study findings reverse key chronology for development of Alzheimer's disease

...ed that oxidative damage precedes the plaques -- a reversal of existing theory that opens new paths of inquiry in combatting an illness that afflicts one out of every 10 persons over the age of 65. "Alzheimer's Disease is a very complex disease that does not appear to have a single cause, but our research...

Worlds largest scientific society convenes regional meeting June 24-27 in Durham, N.H.

...izing capacity dropped in 1988, and the successful reversal of acid problems are presented. (Joseph C. Tausta, Chemistry Department, State University College at Oneonta, N.Y., 607-436-3178). How does your garden grow? This presentation by middle school age students examines growing conditions on vitamin a...

Moving gene in plant results in increased production of amino acid

...tosynthesis occurs. The approach essentially is a reversal of evolution.The biosynthesis of tryptophan and other essential amino acids occurs in these plastids, said Archie R. Portis Jr., a University of Illinois crop scientist and researcher in the USDA-Agricultural Research Service Photosynthesis Research ...

Abstinence may make the brain grow stronger

...nged abstinence from alcohol appears to allow some reversal of structural brain damage. Substantial research...veal that prolonged abstinence may lead to partial reversal of structural brain damage, which suggests that brain function can improve with abstinence. "We want...

Dietary supplements make old rats youthful, may help rejuvenate aging humans, according to UC Berkeley study

...on State University, Corvallis. "And we also see a reversal in loss of memory. That is a dual-track improvement that is significant and unique. This is really starting to explode and move out of the realm of basic research into people." Based on the group's earlier studies, the University of California patent...

1 2

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid