Tag: "role" at biology news

Researchers report new gene test for isolated cleft lip and palate

...ing protein called a transcription factor, plays a role during development in orchestrating the normal for...left lip and palate, hoping some might also play a role in causing the isolated condition. Syndromic cleft lip and palate refers to babies born with clefts...

Newly discovered protein may be key to muscular dystrophy

...n of a newly discovered protein may play a central role in muscular dystrophy, a disease of progressive mu...s, an animal which has provided early clues to the role of a number of important molecules in the human nervous system. The researchers expect that the prot...

NIH roadmap for biomedical research focus of chemists at American Chemical Society meeting

...tute of General Medical Sciences, will discuss the role of chemists at the 228 th national meeting of the American Chemical Society, the worlds largest scientific society. Dr. Berg will describe how chemists can work with biologists to impact progress in medical research by participating in the NIH roadm...

UCR earns $1.5 million grant to examine how engineered crop genes stray

...of Natural and Agricultural Sciences, stressed the role of UCR's Biotechnology Impacts Center as "an honest broker" in this debate. "The scientists conducting this research have no stake in the policy outcomes," Angle said. They hold no patents on genetically modified plants. The study will provide solid ...

New clues to hereditary blinding disease found

...ical School researchers have discovered a critical role for zinc in retinitis pigmentosa. The amount of zi...ation that zinc is present and plays a significant role in the normal folding and functions of rhodopsin, and if defective, leads to retinal degeneration. "...

New 'clock gene' uncovered

... to go further and prove that Rora protein plays a role in the circadian rhythms inside a living creature. They observed a mutant murine model that has a defective Rora gene. This murine model is called "staggerer" because its genetic defect causes a characteristic loss of coordination. As it turns o...

Sweet success in targeting sugar molecules to cells in living animals

...tanding of embryonic development. But studying the role of cell surface sugar chains, called polysaccharides, in disease is best done in the context of multiple cells, said Bertozzi. "All the interesting biology we want to study takes place at the level of whole organisms. This is a general feature of gly...

Other highlights in the August 18 JNCI

... MIC-1 gene, which is thought to play an important role in the inflammatory response to infection, could be associated with the risk of prostate cancer. Contact: Henrik Grnberg, Ume University, 46-90-785-1982 or 46-90-785-6888, henrik.gronberg@oc.umu.se Gene Hypermethylation May Help Predict Neuroblas...

New mechanism for display of foreign proteins to immune system

...how that the cysteine protease Cat S plays a major role in generating presented proteins for the TAP-independent pathway of crosspresentation and contributes to immunity to viruses and transplanted tissues. "We show unequivocally that this pathway is truly separate from the conventional TAP-dependent path...

Progress in breast cancer progression

...ther, these data provide evidence for an essential role of NF-kB in the induction and maintenance of the transition that cancer cells undergo to become invasive and mark the NF-kB pathway as a potential anti-metastatic therapeutic target. ...

Putting energy into heart protection

...rgy in the heart and plays an important protective role during and after a heart attack. The identification of novel AMPK targets and/or the possible use of AMPK activators may be useful in providing therapy for healing during or after a heart attack. A related commentary in this issue by D. Grahame Har...

JCI table of contents, 16 August, 2004

...rgy in the heart and plays an important protective role during and after a heart attack. The identificati...ther, these data provide evidence for an essential role of NF-kB in the induction and maintenance of the transition that cancer cells undergo to become inva...

Medication reconciliation, pharmacist involvement vital to reducing medication errors, study finds

...rly demonstrated that pharmacists play an integral role in this," adds Gary Noskin, M.D., a study author, the medical director of Healthcare Epidemiology and Quality at Northwestern Memorial and professor at Northwestern's Feinberg School of Medicine. "And what this paper demonstrates is that medication ...

Gene duplication allowed pigs to have more babies

...d that the new aromatase genes could have played a role in altering the reproductive behaviour of the animals. By studying the structure of the different enzymes encoded by the three genes, Dr Benner and his colleagues found small differences in the amino acid sequences within the protein's substrate-bin...

Rare mutations can significantly increase risk factor for heart disease

...ed in this study can be generalized to analyze the role of rare variations in candidate genes in other cli...d diagnostic tests. This new understanding of the role of rare genes is just one piece of the complex network of factors that shape heart disease risk, but...

Protective gene may enhance vaccine responses

...ion within hours. "Spi2A appears to play a crucial role in regulating contraction," Ashton-Rickardt said. "Increasing Spi2A levels alone can increase the survival of memory T cells from the standard 5 to 10 percent up to about 40 percent. His lab has already begun to test small molecules that mimic the...

Schizophrenia gene variant linked to risk traits

...e is a key neurotransmitter long thought to play a role in schizophrenia. The gene identified in this study makes the glutamate receptor (GRM3) which is responsible for regulating glutamate in synapses--spaces in between brain cells--where chemicals like glutamate transfer information from cell to cell. T...

Gene changes linked to increased eye pressure may have implications for glaucoma therapy

...search team now is trying to better understand the role of these proteins in the regulation of pressure by the TM."Our goal is to determine if one of these proteins can be used to treat glaucoma," said Borrs. ...

Body's own defense against H. pylori, cause of stomach ulcers and stomach cancer

... investigated the possibility that it might play a role against infection by H. pylori. They isolated mucin from the upper and lower layers and found a key difference: surface-derived mucin actively supported H. pylori growth, while mucins from the second layer inhibited growth. H. pylori in the...

Infants sighs may 'reset' breathing regulation mechanism as well as help lungs develop

...the technical phrase for sighs, play a significant role in helping the mechanical function of healthy lung...archers hypothesized that sighs may play a crucial role in resetting mechanisms for the negative feedback system responsible for controlling breathing, some...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument