Tag: "row" at biology news

Mathematical analysis could aid flu vaccine selection

...racterize these transitions never occur twice in a row in the same region of the viral surface. "It can't repeat the same trick for evading the immune system," said Levin, noting that this information also may be useful in predicting the course of flu evolution. The researchers noted that the strength of...

Does a vegan diet have a moral basis?

...nseen mortality that accompanies the production of row crops and grains, staples of a vegan diet, in agricultural systems large enough to sustain the human population. "Over the years that I have been studying animal rights theories, I have never found anyone who has considered the deaths of - or, the '...

Fulbright fellow develops environmental biology courses in Zimbabwe

...he HIV virus, he said. "We passed a cemetery with row after row of freshly dug graves and multiple funerals going on at the same time." But he also saw the countrys...

Officials design Web-based software for managing hazardous chemicals

Remember your high school chemistry lab with row after row of Bunsen burners surrounded by shelves filled with all sorts of toxic chemicals? Keeping an invento...

Roadsides may provide butterfly corridors

...native grasses. All the roadsides were bordered by row crops. The butterflies were The researchers found that prairie roadsides benefitted the regal fritillary and other butterflies that were more sensitive to habitat disturbance such as row-cropping and urban development. These "habitat-sensitive" butt...

Reefs and atolls of the Australian outback

...-established some distance away," said Dr Lemon. A row of reefs now stands along the edge of the diapir. Lime precipitated by the bacteria has turned to dolomite; far more resistant to weathering than the surrounding green shales. The outcrop is unusual in that all the reefs have been tilted on their si...

Feathers on reptile older than dinosaurs, reported in Science

...first report of the fossil in 1970, he described a row of long narrow appendages down the animal's back, ...appendage. A short distance from the base, a dense row of fine strands called "pinnae" project from either side. Neither the shaft nor the pinnae are typic...

Warman named to Hughes Institute

...orms of the disease. This is the second year in a row that a CWRU researcher has received this award. Last year, Dennis Templeton, associate professor of pathology, was one of nine researchers in the United States to receive it for his studies in colon cancer. The Clinical Scientist Awards are intended...

Scientists dissect bacterial crosstalk

...zing these strains, she identified five genes in a row that shareda regulatory region. Four were involved in fucose uptake or metabolism. But the first coded for arepressor protein, FucR. Hooper purified the repressor and studied FucR mutants.She deduced that the protein halts the transcription of the fi...

Agronomists offer alternative approaches to gulf pollution

...percent isn't fair." More than half of the row crop farms in the Midwest use tile drainagesystems to remove water so that the farmers can get into the fields for springplanting. Turco says that this drainage system is possibly a conduit betweenMidwestern fields and the Mississippi River. "With ti...

Cardiac surgery patients at higher risk

...y, allowingan electrical charge to conduct along a row of cells, causing the heart to beat.Hypokalemia results when the level of potassium in a person's blood becomes toolow. Hypokalemia is usually caused by gastrointestinal or renal problems orprolonged treatment with certain prescribed medications. Bot...

Could Humpback Whales Be Singing Grammatically?

.... "You'd expect to see whether he sings 'Row, row, row your boat' allday long or whether he's a Mozart," he says....

Evidence Mounts Against Maintstream Dogma In Embryology, Could Shed New Light On Neurological Defects

...s to induce the formation of floorplate, a crucial row of cells that lies along the floor of the ventralbrain and spinal cord. This belief has come under fire recently, as new data about floor plate development cast doubt on the authoritative role ofthe notochord. A group of scientists at the Carnegie ...

Alaska Scientists Say Salmon Declines Inevitable

...e until you've seen five years of bad returns in a row or five years of good returns in a row," says Adkison. UAF assistant professor of oceanography Tom Weingartner also isn't ready to say a regime shift is under way, but he has noticed dramatic changes in the ocean. "Certainly over the last year we hav...

National Science Foundation Is Taking Small Business Into A New Phase Of Innovation

...to establish the value of applying theirproduct to row crops, such as corn, and for bedding and garden plants. {Contact: Alan Kinnersley, (517) 336-4675/ kinnersleya@auxein.com } A Vector/Scalar Magnetometer To Study Planets From Orbit Polatomic, Inc. Richardson, Texas With Phase IIB funding, Polatomi...

Composting Livestock Waste Provides Benefits

...e is room for 13 rows of composting material. Each row is approximately five feet high, 10 feet wide and 250 feet long. The rows are turned using a specialized windrow turner. The site development costs for the composting project were approximately $4,600, which included bulldozing a slope, berm, and ret...

New Evidence For Corn's Ancestry Could Lead To Insect And Drought Resistant Crops

...ls. It also has hard seedsthat line up in a single row -- called a "spike." However, Mangelsdorf once believed one of corn's true ancestors was Tripsacum ,a grass that ranges throughout North and South America. "It's a pervasiveweed around here," Eubanks said. "It's on roadsides, railroadtracks and bri...

1 2

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker