Tag: "season" at biology news

New Research Shows Loggerhead Sea Turtles Sustain Delicate Dunes

...id preliminary indications showthis year's nesting season was successful. The nests are laid by sea turtles that can feed as far as 1,500 milesawayfrom beaches where they lay their eggs. Sea turtles swim to nesting areasand carry nutrients from feeding grounds to sandy beaches. Feeding groundsare ne...

New Phylloxera Strain Poses Threat Primarily To Grape Nurseries

...s. Nurseries will have to spray several times per season to control thefoliar form if it spreads, although pesticides do not control it completely. Growers who have already switched from non-resistant rootstocksuch as AXR will not be affected. Growers who have yet to switch are at mostrisk -- the Sier...

Fall Meeting: Updated Press Conference Schedule

...e;o and the disasters caused by the 1998 hurricane season have focused public attention on the damage associated with natural hazards, which also include earthquakes, floods, fires, and volcanoes. The geophysical community's new models and technologies have improved understanding of these phenomena, but how...

Migratory songbird breeding linked to winter habitat

...d young males into the drier scrubhabitat. As the season progressed, the researchers found that birds in the wetforest maintained body mass and showed other signs of being in robust physicalcondition, whereas those in the scrub habitat lost body mass and showed signs ofdeteriorating condition. These facto...

Old Growth Forests May Shed Light On Worldwide Greenhouse Effect

...tended their current measurements to thenon-growth season (September 98-May 99) to compare the data between growing andnon-growing season, and find out whether young plantations are net carbon sinksor sources to the atmosphere once annual carbon budget is calculated. "Thisstudy is a part of the AmeriFlux c...

Biotech Creates New Solutions And New Problems

...750-milliliter bottle of sparkling pear wine.Early season release of Willamette mites confers plant resistan...lamettemites at low densities early in the growing season consistently reduced highpopulations of Pacific mites throughout the season. Willamette mites can be...

Antibody Revolution Targets STDs, Stomach Viruses, Common Cold

Just as the cold season descends, scientists at The Johns HopkinsUniversity are predicting a new wave of cheap, widely available medicines tostop sexually transmitted diseases, protect stomachs from gastrointestinalviruses and defend against the common cold. ...

Colorado State University Study Reveals Climate Change, Longer Growing Seasons Could Harm Grazing On Western Shortgrass Steppe

...t warmer nights are producing a lengthened growing season andchanges in prairie vegetation on the shortgrass...avor cool-season grasses andweeds over native warm season plants like blue grama grass. The team's findingsappear in the current (Jan. 8) issue of the journal...

New Accident Record Analysis Shows Deer Mishaps Climbing

...highways, more roads and gunfire during thehunting season that keeps the animals moving, he said. "Between summer and fall, the deer diet changes as well," Osborn said."They go from eating chiefly grass and leaves to acorns, corn and other crops.That carbohydrate diet gives them more energy and m...

Technology Reduces Reliance On Fungicides For Grape Growers

...ee fewer fungicide applications during the growing season withequal or better disease control," says Gubler. "That means better grapes forwine production and potentially fewer fungicide applications which is easier onthe environment." For more details on the forecasting model for powdery mildew, visit the A...

Scientists Study Protein's Role In Tumor Development In Fish

...ear in the fall and die during the spring spawning season --seem to pose no health risk to humans, according to officials with Ohio SeaGrant. Walleye infected with the tumors have been reported in rivers and lakesthroughout North America, including in Ohio, New York and Canada. Researchers suspect i...

Sustainable Harvest Of Caiman Falls Short Of Potential

...g is restricted to a fewmonths before the breeding season and is limited to those longer than six feet, which sparesfemales. Over the program's first 12 years, more than a million spectacledcaiman were harvested, with an export value of more than $115 million. Until last year, a percentage of the caiman pr...

Research Bears Fruit, And Patents

...o the unusual color," but bythe end of last year's season he was beginning to get requests for specialoccasions. Farley has grown Caroline for production since 1997. "Caroline is red andcapable of producing good crops of larger, more flavorful, and more cohesivefruit one-to-three weeks earlier than standard...

Scientists Use Fossilized Emu Eggshells To Discern Changes In Vegetation, Provide Additional Evidence Of Human Impact On Australian Landscape

...his, in turn, servesas a proxy for the predominent season of rainfall. The evidence is consistentwith a hum...lia. Toreconstruct changes in vegetation, and the season of predominant rainfall, theresearch team analyzed the stable carbon isotope composition of fossiliz...

Fossilized Emu Eggshells Give Clues To 65,000 Years Of Vegetation And Climate Changes In Australia

...3 and C4 grasses over the continent depends on the season of rainfall-C3 grasses dominate southern Australia...nsume during its breeding season. The summer rainy season influenced by the monsoon from the north, they argue, was more extensive at this time, so that C4 gr...

Herbivores, pull up a chair to the table: salt marsh plants at higher latitudes more palatable, according to new study

...ed feedingtrials at least twice during the growing season for two different years [1997and 1998] to determine if seasonal differences exist. We found that for everyplant species tested, there was a striking trend for herbivores to consumegreater quantities of plants from the north when given a choice-- and ...

Satellite fire alarms keep watch on raging California fires

...here are a number of fires around Los Angeles each season becauseof the dry conditions and the Santa Ana winds, so that's where we startedlooking." The system worked well, and this July, Flynn turned his attentionto the entire West Coast to monitor fires in all of California, Oregon, andWashington. The rese...

Hurricane Floyd signal of a new weather era?

...n of State Climatologists. "This hurricane season started late, but it's already had about anaverage amount of hurricane activity and it's only halfway over," Taylor said."It's going to be a very busy hurricane season, just as four of the last fiveyears have been. And the Pacific Northwest is going ...

USGS fire research in the southeast

...al Florida was ablaze. The disastrous Florida fire season that year waslargely the result of an unusual sequ... Grace says burns conducted during the growing season may be the most effectiveway to combat tallow and to restore the natural fire dynamics of the coasta...

USGS studies wildfire ecology in the western United States

...earchers can determine the year and often even the season in which the fire occurred. Allen's team has put together over 4,500 fire dates, from over 600 trees, logs and stumps. "The Jemez is one of the better-sampled landscapes of its size anywhere," says Allen. "Very few areas have as much fire histor...

1 2 3 4 5 6 7 8 9 10

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning