Tag: "selectively" at biology news

International study findings link acne-like rash to effectiveness of new targeted cancer treatment

...eatment a monoclonal antibody designed to home in selectively on a protein called the epidermal growth factor (EGFR). EGFR is found on the surface of some cells and plays a role in regulating cell growth. Cetuximab interferes with the growth of cancer cells by binding to EGFR. It is approved by the Food and Dru...

Belgian researchers explore revolutionary approach to angiogenesis

... is that we may have the potential to use drugs to selectively exploit these blood vessels against the tumour ins...this case a cyclic peptide called BQ123 to target selectively one of the ET receptors, ET-A, that we found was particularly dense in the tumour arterioles. This p...

DNA lends scientists a hand, revealing new chemical reactions

...ghly dilute molecules are directed by enzymes that selectively bring certain biological reactants together. Liu and his colleagues use DNA as a similar type of intermediary to bring together synthetic small molecules that are otherwise too dilute to react, allowing minute quantities of sparse molecules to behave...

Cannabis may help combat cancer-causing herpes viruses

... Immunology. The USF researchers suggest that THC selectively inhibits the spread of gamma herpes viruses by targeting a gene these viruses all share called ORF50. Dr. Medveczky emphasized that more studies are needed. "We have not evaluated the effect of THC in an animal model yet so we do not recommend peopl...

Yale digital diagnostic technology is basis of new company, HistoRx Inc.

..., pharmaceutical and biotechnology companies while selectively licensing its technologies to leading academic and research laboratories. "HistoRx is a great example of the continuing effort of Yale University to expand the biotechnology industry in the New Haven area," said Jon Soderstrom, managing...

Targeted therapy knocks out pediatric brain cancer in mice

...rs conclude that the development of compounds that selectively block Shh may be an appropriate direction for designing effective, nontoxic treatments for medulloblastoma. "Ultimately, it is likely that success in treating cancer will require the use of several compounds in concert that target distinct pathways i...

DuPont developing new protective suits for military, first responders

...and Kevlar, these new, lightweight suits contain a selectively permeable membrane developed by DuPont that will h...ctive transport -- the diffusion of water across a selectively permeable membrane -- this membrane allows sweat evaporation and body heat to escape to keep wearers...

Molecular staples shape a cancer killer

...cular surgery to stabilize the molecule so that it selectively triggers cell death. The idea for developing the compound emerged from the HHMI laboratory of Stanley J. Korsmeyer, who leads one of the hottest research teams currently studying programmed cell death, or apoptosis, a genetic program that executes c...

Study reveals first genetic step necessary for prostate cancer growth

...sed this by using a mouse system that allows us to selectively eliminate genes in the epithelial cells of the prostate. Our experimental approach allows us to closely mimic what happens in man and gives us a glimpse into the natural history of the disease that we haven't had before." Greenberg developed a widely...

Researchers uncover secrets of immune system's munitions factory

... this process, known as somatic hypermutation, AID selectively "damages" the DNA strand, prompting the DNA repair system to create the mutations. AID also triggers class switch recombination, a highly specific process that involves recombining gene segments that encode the part of the antibody molecule that dire...

Regular physical activity really does boost immune system in older men

... physically active lifestyle in the older subjects selectively maintained the function of that specific T cell subset. Importantly, antigen-driven responses, but not total antigen nonspecific Ig, were affected by age or exercise, suggesting this measure is truly reflecting alterations in the in vivo function of...

Congress to fund Sequim-based coastal security research effort

...and sensors. These "smart" sensors are designed to selectively capture and preconcentrate signatures in the marine environment. "The vision is to establish a network of sensors and biosensors that can be easily and inexpensivelydeployed across wide regions on or near the shore. This network would serve as an ear...

Scientists reinvent DNA as template to produce organic molecules

...ghly dilute molecules are directed by enzymes that selectively bring certain biological reactants together. Liu and his colleagues are now using DNA as a similar type of intermediary to bring together synthetic small molecules that are otherwise too dilute to react, allowing minute quantities of sparse molecules...

New understanding of the machinery of flinching

... reduced neuronal activity in the polysensory zone selectively reduced the sustained, directed phase of the flinch. The researchers' analysis indicated that the effects on the polysensory zone were partly due to alteration of the muscle response as well as to effects on the sensory response to the air puff. The ...

JCI table of contents, 16 August, 2004

...r, have now created a mouse model in which ET-1 is selectively disrupted in the collecting duct (CD) and investigated its physiological importance. These mice, when fed a normal Na diet, were hypertensive, but their body weight, Na excretion, urinary aldosterone excretion and plasma renin activity were similar t...

Newly designed nanoparticle quantum dots simultaneously target and image prostate tumors in mice

... into the circulatory system of the mice, the dots selectively accumulated at the site of the tumor through binding to the antigen target. The new triblock polymer coating protected the quantum dots from attack by enzymes and other biomolecules. The active method of tumor targeting using the monoclonal antibod...

Oxygen sensing in worms may hold key to healthy blood pressure in humans

...ter understanding of how these enzymes are able to selectively bind to nitric oxide or oxygen will have implications across a wide swatch of biology, including research into human cardiovascular diseases. Says Marletta, "What I love most about this project is that we started out simply trying to understand how ...

Researchers discover how worms' noses sense oxygen

...or screen out oxygen from the heme binding site to selectively detect one or the other. "This experiment helps us... NO receptors in muscle and brain are able to bind selectively to NO in low concentrations even when oxygen is present in far greater concentrations," he said. "Th...

Tracing a killer's path in Lou Gehrig's disease

...ments in mice showing that the mutant SOD1 protein selectively migrates to the mitochondria of spinal cord neuron...limpses into how cells from the spinal cord may be selectively targeted for degeneration in models of ALS," wrote the researchers. "We propose that the universal a...

Wistar-discovered antibody will help diagnose appendicitis

...radioactive technetium to create NeutroSpec, binds selectively to the CD15 receptor on neutrophils, a type of white blood cell that travels through the body to sites of infection. When injected into the blood, NeutroSpec binds to neutrophils battling an infection, allowing physicians to detect the infection with...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan