Tag: "share" at biology news

For imitative parrots, wagging tongues may be key to vocalization

...different speech sounds. Although birds and humans share the capability to make very complex vocalizations, it was generally believed that most of birds vocal complexity originated from the vocal sound source, the syrinx. The role of vocal-tract articulators, so important in humans, was believed to be only...

How do you mend a broken heart?

...cements. "We've been given a unique opportunity to share the expertise, facilities, models and knowledge of this superb group of scientists." And although many of these scientists already collaborate in pairs, she emphasizes that "as a team we will be able to move much faster towards applying our collectiv...

Probing the surface of white blood cells to enhance immune system medicine

...for transplant recipients. Since many cancer cells share the same mechanism of extravasation as lymphocytes, ablating microvilli could also prevent metastasis of cancer cells to distant parts of the body. Similarly, by thwarting lymphocyte migration to deposits of cholesterol in coronary arteries, drugs co...

APS showcases 46 historic breakthrough research articles

...al Society (APS) recently embarked on a mission to share more than 100 years of physiological research through its Legacy Project. The arduous project that included scanning hundreds of original journal volumes the equivalent of more than 200 linear feet of shelf space dating back to 1898 has "truly bee...

Discovery of new shrimp species adds to unique family

...imp while they build burrows underwater. They then share the burrow. But while there are biologists studying other shrimp families, few are currently studying the snapping shrimp....

Visiting African scientists collaborate with MBL scientists on infectious diseases

...fectious diseases. The African scholars will also share their first-hand knowledge of the impact infectious diseases have in their home countries, and will develop strategies with MBL scientists to combat these diseases. One important pathogen studied by the visiting scholars in the GID program is the Afr...

Gold quantum dots have applications in biological labeling, nanoscale optics

...erties of small clusters of noble metals, how they share conduction electrons, and how they fluoresce under quantum confinement. "They can help us understand the very small size scale that is really not well understood for noble metals," Dickson added. "They can provide the 'missing link' between atomic a...

Why your knees and quads hurt more after running than walking: You're only human

... lot. Why? Because you're human. Though humans share a lot of qualities with other mammals, we are unique in terms of posture, locomotion and gait. (In fact, we're among the only two-legged mammals who walk and run.) For instance, horses consume about the same amount of energy to cover a mile when runn...

5AM Solutions releases Microarray Enterprise Manage(TM) Software

...s solution will result in scientists being able to share data quickly and obtain real insight into human di...results public across. "We can finally seamlessly share data across the consortium and across the world," said Stephan. Dr. Tom Miller, who provides NIH ove...

Ovarian cancer sheds tumor suppression with loss of estrogen receptor

...ta reintroduced into the cancer cell lines did not share the classic functions attributed to estrogen receptors, including induction of progesterone receptor expression and fibuline-1C, and it's ability to decrease the expression of the cyclin D1 gene was completely opposite of it's counterpart, ER beta. F...

Schizophrenia gene variant linked to risk traits

...ople with schizophrenia and their healthy siblings share the inefficient brain physiology, and cognition patterns, which suggests a link to genetic risk, though the disease itself is most likely caused by a combination of genetic and environmental factors. The gene seems to affect the mechanism of memory e...

New comprehensive textbook on companion animals fills need

...ice, rabbits and turtles, to name only a few, that share space in human homes. So many companion animals, and so many opportunities for jobs as veterinarians, veterinary technicians and technologists, trainers and animal behavioralists, groomers, operators of pet motels and boarding facilities, and pet sit...

Parasitic cowbirds thrive with a less ruthless strategy than cuckoos

...nce of nestmates. While cuckoos are far too big to share the nest and food with any other chicks, Kilner thought that her hypothesis could be tested in the cowbird, which is about the same size as its hosts - some 100 different insect-eating passerines or songbirds. "Genetically, you don't benefit from gro...

Commercialization deal boosts hope for new sickle-cell drug

...mercialize ICA-17043 in the United States and will share equally in future development and commercialization costs and benefits. McNeil will receive the rights to develop and commercialize the product in most international markets. Icagen, Inc. will receive royalties from product sales in those countries, ...

Related productivity tools complement computed tomography in lung cancer detection

...ted scientists and clinicians. The URI is meant to share medical data and introduce research protocol. It is also expected to augment ultrasound characterization of specific diseases and improvise ultrasound usage in contrast materials development, signal processing, and tissue characterizations. "The URI ...

Good bacteria trigger proteins to protect the gut

...ntact with myriad commensal bacterial species that share many molecular characteristics of pathogenic bacteria," said Medzhitov. The predominant view, he said, was that TLRs were somehow prevented from recognizing commensal bacteria, yet unleashed specifically against pathogenic microbes. To better underst...

How wounds heal Clues from flies

Anyone who's endured their share of childhood scrapes has probably heard some version of the motherly admonishment, "Don't pick that scab, you'll just make it worse!" It turns out, Mom was on to something, according to research published on-line in the open-access journal PLoS Biolo...

Was Atkins right?

...same time, high protein diets are attracting their share of critics, among them the American Heart Association, which has stated that the focus on animal proteins cholesterol raises harmful LDL cholesterol levels. The scientific community knows that high protein diets induce early marked metabolic changes ...

Carnivore extinction risk determined more by biology than human population density, says study

...from an increasing human population with whom they share their space, say scientists in a study published this week. Researchers looking at all 280 carnivore species around the world estimated the risk of their extinction by 2030 based on a variety of different threats. They found that while a high human ...

Hormone helps fish to mate, may affect human hearing

... the houseboaters when they discover that they may share some things in common with these vocal Lotharios of the sea. And we hope that others who study the human auditory system will be inspired by these experiments." The fish study, which was supported, in part, by the National Institutes of Health, show...

1 2 3 4 5 6 7 8 9 10

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue