Tag: "shift" at biology news

Belgian researchers explore revolutionary approach to angiogenesis

...em by anti-angiogenic drugs constitutes a paradigm shift in approach to angiogenesis," Dr. Feron told a news briefing today (Thursday 30 September) at the EORTC-NCI-AACR[2] Symposium on Molecular Targets and Cancer Therapeutics. The key to the ability of tumour arterioles to contract lies with endothelin-...

Study: Emission of smog ingredients from trees is increasing rapidly

...nd support to proposals among environmentalists to shift attention to regulating NOx, the other main ingredient for ozone. They also underscore the pervasive effect of human activities on the environment, because something as seemingly benign as planting forests can have a substantial impact. "You can't i...

'Fossil genes' reveal how life sheds form and function

...uggesting that the yeast experienced an ecological shift that somehow removed galactose from the organism's menu, thereby making the galactose-processing genes obsolete. The relic genes, according to Hittinger, are "full of holes," where numerous DNA bases - the building blocks of all genes - have been edi...

JCI table of contents September 15, 2004

...esponse to CpG-DNA. Northern blot analysis and gel shift assays demonstrated that enhanced IL-12 levels occurred at least partially through loss of transcriptional repression. In vivo, OVA immunization and Leishmania major infection in Cot/Tpl2-deficient mice showed Th1-skewed antigen-specific immune respo...

News tips from the Journal of Neuroscience

...ttention modulated the response function without a shift in the time or shape of the response. Thus their results suggest that attention increases the sensitivity of neurons without affecting the temporal characteristics of the response. 3. JNK signaling after ischemia : The JNK signaling pathway media...

Evidence for sympatric speciation by host shift in the sea

...the authors show that sympatric speciation by host shift is the simplest explanation for the pattern of hab... of animals for which sympatric speciation by host shift has been reported, thus providing support for a general set of ecological conditions that favor symp...

New 'clock gene' uncovered

...is discovery may someday help people with jet lag, shift workers who feel wiped out after working a night s...entally, the problems related to jet lag and night shift work are often caused by the liver's inability to respond rapidly to changes in the sleep-wake cycle...

NHGRI adds 18 organisms to sequencing pipeline

... African savannah elephant and domestic cat. In a shift from NHGRI's previous procedure of choosing sequencing targets one at a time on the basis of proposals from individuals or groups of scientists, the National Advisory Council for Human Genome Research (NACHGR), a federally chartered committee that ad...

Group dynamics

...nfluence of viruses and bacteria, the session will shift to the miniscule but mighty genes. In "Interactions within families and the evolution of social behaviors," Michael Wade (Indiana University-Bloomington) will examine the role of genetics, especially those from the mother, in the development and sha...

Where the sage-grouse roam

...he changes to the sagebrush biome the session will shift to restoration and land management. David Pyke (USGS) will describe the results of a four-state study of Bureau of Land Management wildfire rehabilitation projects in his presentation, "Restoration and rehabilitation Bridges to build and impediment...

Climate change could doom Alaska's tundra

...ires should become less frequent overall and could shift from central Alaska to the northeast. Insects and pathogens, which can adapt more readily to changing environmental conditions, may cause massive epidemics of plant disease and insect attack in some cases causing large forest die-offs that could...

New diagnostic technology helps justify earlier cataract surgery

...patients often complain of glare, double vision, a shift in colors, and other problems. "There have been innumerable articles and textbook chapters noting that the Snellen test does not document the visual deficits experienced by cataract patients," said Samuel Masket, MD, chair of the Eye Surgery Educatio...

Reaching for the gold

...nce beam," she said. "We can advise them on how to shift their weight just a little or spring up just a little sooner to perfect the performance." McNitt-Gray specializes in force impact to the lower extremities, an experimental modeling technique in kinesiology that can be applied to a wide range of skil...

Putting GPS to work, researchers shed light on road-following by pigeons

...ng pigeons appear to have "a remarkable ability to shift from one homing strategy to another," and they urge that their new findings be reasonably interpreted. Hans-Peter Lipp, Alexei L. Vyssotski, David P. Wolfer, Sophie Renaudineau, Maria Savini, Gerhard Trster, and Giacomo Dell'Omo: "Pigeon Homing along...

Springtime blooms seen earlier now than in the past, say Boston University biologists

...he months February through May, has influenced the shift in flowering times. In addition to its scientific insights, the study may provide a model for public participation in climate change research. The relatively low-tech, data-from-the-community protocol used by the team might open such stu...

Long-term heart damage may result from constant confrontation and defeat

...s repeated challenge episodes. In other words, the shift of sympathovagal balance toward a sympathetic dominance was gradually reduced from the first to the last acute defeat experience. As for long-term consequences on chronobiological parameters, average night and day values of heart rate rose sig...

Significant strides in small regulatory RNA research in plants

Molecular biology experienced a significant shift in thinking in recent years with growing evidence that microRNAs (miRNAs) play a major role in the control of eukaryotic gene expression during development. These tiny RNAs, which have sequence complimentarity to short segments of protein-coding gene...

Hormone helps fish to mate, may affect human hearing

...tes of Health, shows how steroid hormones can help shift the sensitivity of the auditory system to pay more attention to some social stimuli than to others, says Bass. "This system of hormone-based prioritization helps the brain focus on the most important stimuli, at any given time, in an ever-changing en...

New paper in Science introduces revolutionary new paradigm for fishery management

...ustralia. The authors write, "Ideally, EBFM would shift the burden of proof so that fishing would not take place unless it could be shown not to harm key components of the ecosystem." In addition, an ecosystem-focused approach would stimulate research about ecosystem processes and the likely consequences ...

In the obese, metabolic adaptations post-weight loss lead to regaining of shed pounds

...panied by an elevation in metabolic efficiency and shift in fuel utilization such that there was a preferen...t. While rats that are regaining weight may have a shift in appetite that would contribute to their high rate of weight regain, the drive to increase food in...

1 2 3 4 5 6 7 8 9 10

(Date:4/17/2014)... 17, 2014) Two recent papers by a ... colleagues may help scientists develop treatments or vaccines ... Japanese encephalitis and other disease-causing flaviviruses. , Jeffrey ... molecular genetics at the School of Medicine and ... Medical Institute, and colleagues recently published articles in ...
(Date:4/17/2014)... Le Bonheur Children,s Hospital Pediatrician-in-Chief Jon McCullers, MD, ... the April issue of Nature Reviews Microbiology ... Dr. McCullers, a world-renowned infectious disease specialist, ... the University of Tennessee Health Science Center, analyzed ... 1918, 1957 and 1968 pandemics, as well as ...
(Date:4/17/2014)... April 17, 2014U.S. military personnel who served in ... concussive traumatic brain injury (TBI) were compared to ... other medical reasons. Differences in measures of overall ... months after injury are reported in an article ... journal from Mary Ann Liebert, Inc., publishers. The ...
(Date:4/17/2014)... million older Americans suffer from depression, often brought on ... research a project that followed the lives of ... found that Internet use among the elderly can reduce ... , "That,s a very strong effect," said Shelia Cotten, ... and media who led the project. "And it all ...
(Date:4/17/2014)... about one in five infants in the United States ... first several months after birth. Research into probiotic use ... the April 1, 2014 issue of the British ... study, "Probiotics and Infant Colic," concluding that the use ... colic did not reduce crying or fussing in ...
Breaking Medicine News(10 mins):Health News:CU researchers discover target for treating dengue fever 2Health News:Long-term effects of battle-related 'blast plus impact' concussive TBI in US military 2Health News:Internet use can help ward off depression among elderly 2Health News:New study says probiotic use for infant colic is not effective in reducing symptoms 2
Other Tags
greatlyrumorsintegrityoctopussecretsbacteriumanthraxpotentialscreendefencesevadeshieldlovedincapacitatedwishespacemaker