Tag: "shift" at biology news

How trees changed the world

...rous (Pennsylvanian) rocks worldwide, this radical shift in the Carbon Cycle also lowered the global greenhouse effect and led to global cooling, giving rise to long-term glaciations. The effect of deforestation on the modern world climate cannot therefore be underestimated at a time when global liberatio...

Microbes and the dust they ride in on pose potential health risks

...stern Amazon Basin. From June to October the winds shift and typically bring dust to North and Central America and the Caribbean." During the peak of the dust season in July 2000, Garrison collected samples of airborne pollutants and dust daily on the island of St. John in the Virgin Islands and sent them ...

Beyond global warming: Where on Earth are we going?!

... such rapid changes occurring simultaneously could shift the Earth into different modes of operation that may have significant impacts for human life, says Dr Steffen. Plenary speaker, Professor Tom Pedersen, Chair of IGBP-PAGES (Past Global Changes), warns that humans have a false sense of security about ...

Ancient oceans experienced a global surge in biological productivity

... a regional scale, and that it was not linked to a shift of nutrients but instead to a worldwide, overall increase in nutrient supply. In other words, the biogenic bloom was a lot like Camelot. Now the researchers are trying to understand what caused the increase in nutrients. They suspect that rapidly r...

AIDS in Africa has potential to affect human evolution, UC Berkeley scientists report

... percent of the population to only 10 percent. The shift in frequency of these genes would effectively leng...e year, from 7.8 years to 8.8 years. The frequency shift is primarily due to the opportunity for continued reproduction during the extra two to four years, a...

Kyoto's global warming controls could harm forests

...cies in today's fragmented and degraded forests to shift their ranges in response to climate change. To help forests adapt to climate change, Noss recommends two main approaches. First, we should maintain or restore connections between forests. These include elevational corridors so species can move...

Scientists switch memory recall on and off in fruit flies

...ain involved in learning this simple task. When we shift the temperature back down, normal electrical function is restored." Dubnau, Tully and their colleagues trained flies to avoid an odor and later tested the flies' recall by exposing them to the same odor and measuring their avoidance response. The sc...

Deregulation will cause significant fluctuations in electricity prices, new study reveals

...f 0.9 to 1.3 percent. This trend reflects a strong shift toward natural gas as a fuel source, according to EMF. The study predicts that new gas-fired plants will account for more than 80 percent of the additional electricity generated over the next 10 years. Slower retirement of nuclear power plants also w...

Why missing out on a good night's sleep could give you ulcers

... on a good night's sleep through long haul travel, shift work, or partying could increase the risk of ulcers. Research in Gut shows that levels of a chemical, produced by the stomach and small intestine to repair tissue damage, are highest at night, and are suppressed after a meal. Twelve healthy, 20 to 24...

"Soft" science? Fat's health impacts are often oversimplified, Science news feature contends

...e warnings about dietary fat may have encouraged a shift to high-carbohydrate diets, "which may be no better-perhaps even worse-than high-fat diets." America's fear of fat emerged some 50 years ago, when it quickly replaced malnutrition as the nation's top dietary concern. After World War II, Taubes explai...

Stratospheric balloon constellations for Earth science

...ucture. In todays satellite era there has been a shift away from ground based conventional measuring systems to remote sensing from Earth orbiting spacecraft. National priorities emphasize the use of high technology space systems partly because measurements from ground based locations have been labor-int...

Darwinian evolution of reproductive proteins in mammals

...rise. The protein study could herald a fundamental shift from only regarding commonality between species as evidence for functional importance: "Here, we have focused on what is different, with the idea that evolutionary novelty can also indicate an important function," Aquadro says. "As genomic sequence...

Heat kills inoperable liver tumors without initiating onslaught of harmful hormones

... against liver cancer uses heat instead of cold, a shift that could put the freeze on what until now has been the standard therapy for inoperable tumors. What's more, it's easy, cheap and considerably less risky to perform than surgery or using cold to zap malignancies. Now University of Florida resear...

A bizarre new predatory dinosaur unearthed on Madagascar

...ns for plate tectonics, the theory that landmasses shift their relative positions as they move slowly across the face of the earth. Madagascar was once part of the southern supercontinent Gondwana, which fragmented during the Mesozoic heyday of dinosaurs. The known geographic distribution of abelisauroid ...

New predatory dog-sized dinosaur unearthed on Madagascar

...ns for plate tectonics, the theory that landmasses shift their relative positions as they move slowly across the face of the earth. Madagascar was once part of the southern supercontinent Gondwana, which fragmented during the Mesozoic heyday of dinosaurs. The known geographic distribution of abe...

Global diagnosis completed of ocean regions most sensitive to an iron-rich diet

...an productivity/iron deposition relationship might shift in response to climate change. Behrenfeld is leading a series of NASA-supported research cruises to study in more detail iron-limited areas of the ocean. The first cruise was completed this September in the equatorial Pacific Ocean near Hawaii....

Vanderbilt neuroscientists identify 'oops center' in the brain

... elegantly simple task: deciding whether or not to shift ones gaze. The researchers sat macaque monkeys in ...peared during the time the monkey was preparing to shift its gaze to the peripheral spot. In these cases, the monkey was rewarded when it cancelled the eye m...

UC Davis study shows spirulina boosts immune system

...roduction of interferon-g over interferon-4 would shift the immune system towards mounting a cell-mediated immune response instead of a humoral response. A cell-mediated response includes the activation of T-cells and antibodies that work with macrophages, another type of immune system cell, to engulf inv...

2000 FALL MEETING: updated press conferences, press registration, and other information

... subsidence of the region, and the reasons for the shift of the Nile toward the east sometime after the disappearance of the cities. Panelists: Amos Nur, Professor and Chairman, Department of Geophysics, and Director, SRB Project, Stanford University, Stanford, California; Franck Goddio, European Instit...

Two routes to FAK activation and cancer cell migration

...anges in FAK distribution and activity mediate the shift of cancer cells to a migratory phenotype. Working with cultured pancreatic cancer cells, Sumitomo and coworkers have now identified a dual pathway by which the cell surface transmembrane proteinase neutral endopeptidase (NEP) regulates FAK phosphory...

1 2 3 4 5 6 7 8 9 10

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan