Tag: "solving" at biology news

Paul Ehrlich named Eminent Ecologist for 2001

...e application of ecological data and principles to solving environmental problems. ESA publishes three journals - Ecology, Ecological Applications and Ecological Monographs. "ESA has been increasingly active in bringing the ecological dimensions of the human predicament to the general public and decision mak...

Researchers discover new way to block HIV transmission by removing cholesterol from cell membrane: Hopkins study finds HIV requires cholesterol to infect

... and in the current report, researchers focused on solving the next question. "We wondered why lipid rafts might be important for HIV biology, and our attention focused on cholesterol in the rafts because it's important in a number of biological functions, including fusion," says Hildreth. "We also knew tha...

Structure shows repair protein cradling broken DNA

...ructure was determined, the scientists moved on to solving the structure of the Ku-DNA complex. In their stud...other end of the DNA with a bulky DNA motif. After solving the structure of Ku bound to DNA, Goldberg and his colleagues could see how the Ku heterodimer manag...

Structure solved by scientists at The Scripps Research Institute marks important milestone in effort to develop HIV vaccine

...not form good crystals, an important first step in solving a structure. But by working with an antibody preparation that was unusually pure, the team managed to make crystals and solve the structure....

Better computer modeling provides a new look at large biomolecules

...report that parallel focusing is a new approach to solving the Poisson-Boltzmann equation (PBE), a fundamenta...olph E. Bank and Michael J. Holst, who proved that solving a problem with a low level of accuracy over an entire domain would enable one to use that solution t...

Supercomputer paints electric landscape of cellular structures

...iology." The researchers created a new method for solving what is known as known as the Poisson-Boltzmann equation. This allowed them to increase the size of the systems they could model from less than 50,000 atoms to over an unprecedented million atoms. McCammon likened the ability to pick out one atom wit...

University of North Carolina chemist wins national award for natural products research

...immins chose chemistry because "its very much like solving logic problems," he said. "I've always liked to make things with my hands, and here I can build things I can take pride in."...

American Chemical Society meeting features cutting-edge research August 26-30 in Chicago

...ghlight the latest scientific techniques for crime solving from analysis of gunshot residues to DNA typing. ( CHAL 1-12, Sunday, August 26, 8 a.m.) Nutritional beverages Researchers are gaining new insight into the potential health benefits of beverages ranging from tropical fruit juices to soy-base...

First high-resolution structure of a membrane transporter solved at The Scripps Research Institutea weapon against cancer and antibiotic-resistant bacteria

...not form good crystals, an important first step in solving a structure. But by working with many different protein preparations and testing thousands of different buffer conditions, Chang was able surmount this problem. The research article, "Structure of MsbA from Escherichia coli: A Homolog of the Multidru...

Purple potato boost for organic food industry

...urple potato from Eastern Europe may be the key to solving the biggest economic obstacle facing the organic farming industry. The variety, so obscure that it has no name, appears to be almost totally resistant to potato blight, making treatment with fungicide unnecessary. The discovery by scientists at the U...

First-ever autism research conference to explore new frontiers

...e and the successes of the scientific community in solving the pieces of the puzzle of this complicated disorder will be greatly enhanced."Autism is a complex neurodevelopmental disorder typically characterized by an inability to participate in normal social interactions, language and communication impairmen...

NIH funds synchrotron beamlines to advance studies of molecular structures

...ray crystallography, an area of study committed to solving detailed structures of molecules. The field has exploded in recent years, and a major threat to its continued growth is limited synchrotron resources. Synchrotrons are the enormous machines that produce powerful X-rays used by researchers to tease...

Science's Top Ten: nanoscale computing circuits named top scientific advance of 2001

...ves cracked one of their toughest cases this year, solving the problem of the missing solar neutrinos. Neutrinos are particles with virtually no mass, and "electron" neutrinos are a byproduct of the nuclear furnace that drives the sun. In the late 1960s, researchers calculated the number of electron neutrino...

Study shows deoxygenating ballast water can prevent invasive species and ship corrosion

...dustry, said Tamburri. Its a win-win treatment for solving an environmental problem and reducing ship maintenance costs. Tamburri and Wasson summarize research by Japanese scientists and engineers at Sumitomo Heavy Industries, Ltd. who developed a deoxygenation technique to combat the costly corrosion experi...

Discovery that common mood disorders are inherited together may reveal genetic underpinnings

... genes cause what, but this is a major step toward solving these problems, says MacKinnon. The scientists case for a common foundation emerged from examining the disease pedigrees of 203 families in which at least one family member had bipolar disorder. Interviews with family members led to the identifi...

New sensor being designed to detect, identify invisible agents faster

...his capability could make a critical difference in solving and preventing crimes. Sarafs sponsor for this research is Carilion Biomedical Institute of Roanoke, Va. The institute is a partnership between Carilion Health System, the University of Virginia, and Virginia Tech. Another benefit of Sarafs work wil...

Scientists reveal fine detail of cell's energy machinery

...ersion is shared by a wide range of organisms, and solving this enzyme's structure provides a valuable insigh...of a small number around the world that focuses on solving membrane protein structures using X-ray crystallography. Membrane proteins are technically difficul...

Study to help solve health problems by understanding gene, protein behavior in cells

...rol systemssimulations that can be truly useful in solving military and health-related problems, Tyson said. He likened this to the change in the electronics industry: "When people were designing toasters and crystal radios," Tyson said, "they could do it without a fancy computer. Now, however, electrical...

Imagine no restrictions on fossil-fuel usage and no global warming

...duce threats from weapons of mass destruction, and solving problems related to energy, environment, infrastructure, health and national security concerns....

Los Alamos researcher conducts volcanic voyeurism

...duce threats from weapons of mass destruction, and solving problems related to energy, environment, infrastructure, health and national security concerns....

1 2 3 4 5 6 7 8 9

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning