Tag: "sought" at biology news

Researchers announce first preimplantation genetic diagnosis for a rare inherited disease

...gna, Italy, today (Monday 26 June) how one family sought help from geneticists after the mother was found to be an OTCD carrier. Their first child, a boy, had died shortly after birth; a prenatal test on the next pregnancy found the male embryo was also affected and the pregnancy was terminated. Their thir...

AIDS prevention researchers to gain premier online info-exchange forum

...." Additional collaborators and sponsors are being sought for the AAAS venture, conceptualized with support from Virginia-based telecommunications expert John Evans. A variety of funding structures, including subscriptions, are being evaluated, Rubinstein says....

Nanofabricated 'gel' separates DNA

ITHACA, N.Y. -- Researchers have long sought to create a "laboratory on a chip" that could greatly speed up the process of DNA sequencing. That goal has come a step closer with the announcement that Cornell University researchers have built and tested a nanofabricated device that can separate D...

Genes for unusual flower within a flower are identified by UCSD scientists

...abnormality has long puzzled geneticists, who have sought for years in vain for the genes responsible for this condition. But an important part of the mystery has been solved by a team of biologists at the University of California, San Diego. In a cover story in the May 11th issue of Nature, the scientis...

Gene tug-of-war leads to distinct species

...eir resulting hybrids, Tilghman and her colleagues sought to determine whether disruption of imprinting affects survival of the offspring. An analysis of the animals resulting from such backcrosses revealed that the inviability of the hybrids was partly due to two genes -- one on the X chromosome of the p...

Advanced cell technology reports reversal

...at makes babies young." Medical science has long sought a means to turn back the aging clock by returning old cells to their earliest stages of development. If this can be accomplished it will then be possible to regenerate cells and tissues for the repair of age-related disease. The results of previous r...

Cloning reverses aging in cow cells, a milestone in medical research

... the cells stop dividing. Medical science has long sought to discover a "Fountain of Youth" that could potentially turn back the aging clock to return old cells to their earliest stages of development. If accomplished, this will have tremendous implications for regenerating cells and tissues in order to rep...

Novel antiviral drug concept targets number of human viruses

...tions in humans. Until now, antiviral drugs have sought to attack viruses directly by interfering with essential proteins produced by the viruses. Scientists have long known, however, that viruses are parasites and depend on the cells they infect for crucial support of their life cycles. Using the herpes ...

Environmental and genetic factors influence development of psychiatric disorder

...sychopathology in the general population, would be sought in sets of relationships in which he would be seen as both victim and creator of his fate," said Dohrenwend. Dohrenwend summarized three lines of environmental research that strongly suggest that adversity is important in the development of psych...

Study points to U.S. as generator of greenhouse gases

...ions Framework Convention on Climate Change, which sought international cooperation on reducing greenhouse gas emissions. "In the U.S., some people and policy makers remain unconvinced of the reality of global warming and have concerns about the economic impact on jobs or industry if the country were to co...

Formula additives boost small children's intelligence in study

...he NICHD. In planning their study, the researchers sought to overcome the limitations of previous studies, which produced ambiguous results, explained the principal investigator, Eileen Birch, Ph.D. Some showed a positive effect on intelligence, others showed no effect, while another showed that DHA decrea...

Tobacco farm workers may contract tobacco sickness, Wake Forest study shows

...rkers attempt to treat themselves. "Only 9 percent sought medical treatment," she said, "and 7 percent lost work time." She added, "Many farm workers believe they will be fired and lose their income if they get sick or work too slowly. Green tobacco sickness is an environmental justice issue, part of the g...

ASU scientists probe salamander mysteries

... a different agent was the real culprit. Davidson sought the help of colleague Frank Morado, a marine pathologist at the National Oceanographic and Atmospheric Administration in Seattle. The damage Morado saw in the infected tissue reminded him of a similar infection he had recently seen in salmon and inse...

Advance in asthma research announced

...n Institute. Scientists around the world have long sought a substance to block a structure on the surface of asthma andallergy-inducing eosinophils. The structure, called the CCR3 receptor, is also present on other important cellsimplicated in allergy, including basophils, mast cells and Th2 lymphocytes. Th...

Recombinant protein may play key role in treating immunocompromised patients

...d. For decades, vaccine development experts have sought to find a simple and practical way to activate the killer cells or CTLs using soluble proteins, but finding a method that works has been a challenge. "We were able to solve this problem by taking advantage of the observation that a class of protei...

Targeted Genetics presents advances in synthetic gene delivery technologies

...sues. Systemic, targeted delivery has been a long sought after approach to gene therapy and is the foundation of our joint venture with Elan plc (NYSE: ELN), Emerald Gene Systems." In July 1999, Targeted Genetics and Elan plc established a joint venture, Emerald Gene Systems, to develop advanced gen...

Carilion, Virginia Tech, U.Va. create biomedical institute -- Virginia Tech forms optical sciences and engineering research center

... activated chemical agent. Proposed activities are sought for thedevelopment of photodynamic chemical agents, optical activation techniques and devices. Other Applications OSER will be open to any proposals relating to the biomedical sciences or engineering. As examples,other areas in which proposals ...

Lemur 'Juliet' may be new subspecies; no mate for 'Romeo'

...adagascar. The animals that he and his colleagues sought are "diademed sifakas" -- the largest living lemur and considered among the most beautiful of primates, with lush fur of yellow, orange, gray, white and black. On Oct. 10, after days of searching for animals that were finally spotted by local villag...

A 'Juliet' is found for the rare lemur Romeo

...ash-and-burn agriculture. Theexpedition originally sought to capture three young adult females and two males. The Ivoloina Zoological Park where Juliet and the male are beingacclimatized is a combination lemur breeding facility, zoo, education center andtourist attraction developed over the past dec...

UCSC researchers obtain first detailed images of a complete ribosome

...earchers showed how the two subunits arejoined and sought to interpret the images in terms of how the ribosomefunctions. "It shows just how wide open this field is that three groups can come up withcompletely different spotlights on the problem," Cate said. Noller said future research will proceed in two ma...

1 2 3 4 5 6 7 8 9 10

(Date:5/22/2013)... New York, New York (PRWEB) May 22, 2013 ... for the nation’s first trial involving a da Vinci ... in the case, the family of a man who allegedly ... is seeking more than $8 million in damages from Intuitive ... watered down its physician training program for the da Vinci ...
(Date:5/22/2013)... IL (PRWEB) May 22, 2013 Nearly ... Veterans’ Appeals (BVA) in fiscal year 2012, with even ... themselves waiting longer for a decision as the agency ... Allsup, which provides veterans disability appeal services. ... of Veterans Affairs. , Although the BVA received 49,611 ...
(Date:5/22/2013)... is a gender gap when it comes to behavior ... does not appear to exist in children in Asia. ... of self-regulation than boys. Self-regulation is defined as children,s ... and persist on a task. It has been linked ... by Oregon State University researchers. , In three ...
(Date:5/22/2013)... 2013 Successful Therapy for Parents ... Psychotherapy in the Silver Lake community of Los ... as progression to existing Parents and Couples counseling ... parenting therapy has always been suggested, but now ... now specializes in all aspects of relationships ...
(Date:5/22/2013)... 2013 Diversity Focus and Handicap This ... The performance promotes awareness that physical disabilities do not ... performance will be held Friday, June 14th at 7:30 ... Tickets for Handicap This! can be purchased at ... the level to which their mind is handicap accessible. ...
Breaking Medicine News(10 mins):Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 2Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 3Health News:Da Vinci Robot Lawsuits: Bernstein Liebhard LLP Notes Beginning of Jury Deliberations in Nation’s First Trial Involving Alleged Da Vinci Surgery Complications 4Health News:Veterans Disability Appeals See Fewer Decisions in FY2012, Reports Allsup 2Health News:'Boys will be boys' in US, but not in Asia 2Health News:'Boys will be boys' in US, but not in Asia 3Health News:Patricia O’Laughlin Psychotherapy of Los Angeles Now Seeing Adults, Teens and Young Children 2Health News:Handicap This! Comes to Marion, Iowa 2
Other Tags
penniesswallowgabapentinrelievedlocationtanningguardiansleuthresponsibilitywalkspercentagerankingsavoidscoolingminiinvestigated