Tag: "steer" at biology news

Human-Like Ability, Categorical Perception, Found In Insects

...he company of other crickets. However, failing to steer away from bats' ultrasound could cost the cricket not only its life but its place in the gene pool, explained Ronald R. Hoy, the Cornell professor of neurobiology and behavior whose laboratory conducted the experiments. Researchers led by Hoy report...

Moving DNA Molecules With Magnetic Tweezers

...old of asingle DNA molecule and uses a joystick to steer it carefullythrough a solution. Wirtz, an assistant professor of <ahref="http://www.jhu.edu/~cheme/ChemE.html">chemicalengineering at The Johns Hopkins University, is not playinganelectronic game. He is manipulating molecules in ground-break...

Summer Science: Firefly Babies Advertise Their Bitter Taste, UD Researchers Say

...toward the glowing branch," theyquickly learned to steer clear of the bitter-tasting tidbit, UD researchers say.Within eight to 47 runs, all mice had selected the darkened side of the maze atleast seven times in a row. "Our study answers a fundamental question that entomologists have been ponderingfor some...

Termites' Attraction To Small Amounts Of Carbon Dioxide Lures Pests To Their Deaths

...the gas. The pellets, buried at cornplanting time, steer rootworm larvae off-course. Bjostad's rece...e food andshelter. If so, the gas could be used to steer other agricultural and householdpests away from places they do harm. "Manmade insecticides a...

Ant Pheromone May Aid Alzheimer's Patients

...o far to the left, theleft-hand antennae make them steer to the right. An ant with only one antennawill only zig (or zag). And if ants' antennae become crossed, they arehopelessly disoriented. -- EVOLUTION OF THE CHARISMA CHEMICAL: Not every ant species can draw a crowdwith chemically sophisticated ...

Researchers Take Major Step Toward Cracking Ebola Code

... form of glycoprotein (sGP) mightact as a decoy to steer inflammatory cells away from the transmembrane form ofglycoprotein (GP). However, Nabel says it now appears sGP actually binds toneutrophils and hinders an early inflammatory response that might stop the virusfrom replicating. The second part of the...

ASU Scientists Make Major Breakthrough With Photosynthetic Energy

...multiple technological advancements and could help steer the economy of Maricopa County. ASU chemists Ana Moore, Devens Gust and Thomas Moore; ASU postdoctoral students Gali Steinberg-Yfrach and Edgardo Durantini; and Jean-Louis Rigaud of the Curie Institute in Paris, France, have built a cell-like machi...

More Research Needed To Reach Green Goals

...eeded. Which chemicalsshould be allowed?How can we steer human behaviour and lifestyles in a more environmentallyfriendly direction? New ways The Swedish EPA survey of research requirements shows that SEK3m - 15 m areneeded for eachobjective. The variation depends on research needs and the availability o...

Growing Up On Their Own: Smart Plastics Organize Themselves Into Useful Optical Devices

...are simply trying to build componentsthat bend and steer light as handily as current computer chips manipulateelectronic signals. Today's computers rely on semiconductors, or -- electroniccrystals, -- that give scientists the power to control millions of electronicsignals gliding around a computer chip sim...

Story Tips: Engineering Students Pursue Cutting-Edge Research

...ystem. Under the rulesof the contest, JANUS had to steer itself around an underwater course andthrough six submergedgates without help from anyone watching on the sidelines. In other words, thiscould not be aremote-controlled vehicle. JANUS's "belly" was a water-tight aluminum alloy cylinder that housed t...

Spy flies

... not only how insectsstay aloft, but also how they steer and maneuver. Dr. Michael Dickinson and hiscolleagues have discovered that the aerodynamic performance of insects resultsfrom the interaction of three distinctly different mechanisms: delayed stall,rotational circulation and wake capture. These findi...

UNC-CH bus brings mobile lab, high-tech science focus to underserved N.C. schools

...ewhere working to strengthen science education and steer students toward careers in science. Besides UNC-CH, members of the partnership consortium are Elizabeth City State, Fayetteville State, Johnson C. Smith, N.C. Agricultural and Technical State, N.C. Central and Shaw universities as well as UNC-Pembro...

Integrative approach to studying penguins, cockroaches and little hairy noses makes comparative biomechanics group at UC Berkeley the nation's best

...flyers to maneuver. For these frogs, being able to steer while gliding through a complex forest is probably more important than how far they can travel horizontally, which is how glider performance is usually evaluated," Koehl said. "We create epoxy models of frogs and measure the aerodynamic forces on the...

Alcohol researchers suggest specific binding site for anesthetics and alcohols

...viously thought. We believe this approach can help steer future research to define anesthetic binding sites on other brain proteins."...

Mouse gene trap helps decipher brain's wiring diagram

...on neurons in humans. Growth cones at the axon tip steer a weaving course, taking their cues from chemical attractants and repellents secreted by guidance cells that serve as the lighthouses and buoys of central nervous system development. Receptor proteins on the axons act as the growth cones' antennae f...

Calcium signals found to guide nerve cell development

...er cues released by target cells. As the filopodia steer the growth cones to their target cells, long axons are formed, which transfer chemical signals between cells. In the mature nervous system, the growth cones are transformed into synapses, the communication connections between the nerve cells. "The m...

Researchers find new clues to nerve cell development

...from the neuron's cell body. As the filopodia help steer the growth cones to their target cells, axons are formed along the way. Gomez and his colleagues studied frog spinal nerve cells they kept alive in a culture dish. They loaded the neurons with a fluorescent calcium indicator that allowed them to obse...

Genes don`t control human behavior, evolutionist says

...Project has made it crystal clear that learning to steer cultural evolution is basically the only option available." Challenge In his AIBS speech, Ehrlich challenged his fellow biologists to collaborate with social scientists to develop a more thorough understanding of how culture evolves. "We comprehend s...

$100,000 prize to pioneers in neural research

...ol the growing tips of nerve cells known as axons, steer them to their proper targets, and direct them to make the appropriate synaptic connections. Dr. Goodman has also demonstrated that these genes and mechanisms that control brain wiring are nearly identical in all animal species, including humans. ...

Genes passed from crops to weeds persist for generations

... that biotech companies should steer clear of developing transgenic radish varieties with beneficial traits that could be passed on to weeds, said Allison Snow, a study co-author and a professor of ecology a...

1 2

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan