Tag: "stores" at biology news

Veterans with Gulf War syndrome have damage in specific, primitive portion of nervous system

...soldiers when U.S. forces detonated Iraqi chemical stores during and after the Gulf War. A recent report from the Government Accountability Office confirmed that exposure to low-level sarin in the 1991 Gulf War was more frequent and widespread than previously acknowledged. Subsequent research fro...

Viral suspect for amphibian decline traced to human spread through bait

...nce for this specific virus in salamanders in bait stores in Phoenix and also evidence of it in axolotls (s... tiger salamanders in the wild in the west. "Bait stores collect their animals in the Midwest, for the most part Nebraska, West Texas, eastern New Mexico. W...

Diabetics face fewer healthy food choices in some urban areas

... tougher time finding healthy foods at their local stores than diabetics in New York's Upper East side. Acc...d 151 Upper East Side grocery stores. The Harlem stores were much less likely to stock healthy food choices such as whole-grain breads and diet soda. The r...

JGI announces community sequencing program portfolio

...onal marine economies. Accumulibacter phosphatis stores huge amounts of phosphorus inside its cell. Engineers have exploited this capability to remove excess phosphorus--from fertilizers and detergents--from wastewater. Too much phosphorous can over-stimulate microbial growth resulting in eutrophication,...

RNA could form building blocks for nanomachines

...erstood is RNA, a molecular cousin to the DNA that stores genetic blueprints within our cells' nuclei. RNA typically receives less attention than other substances from many nanotechnologists, but Guo said the molecule has distinct advantages. "RNA combines the advantages of both DNA and proteins and p...

You are what you eat: New insight into autophagy

...d visualization technique. The Drosophila fat body stores nutrients in much the same way that the liver and fat tissue do in mammals. Starvation and inhibition of PI3K or TOR induced autophagy in the Drosophila fat body. "While the molecular machinery of autophagy is largely conserved from yeast to mammals,...

Scientists find 75 percent of red snapper sold in stores is really some other species

...nt of fish tested and sold as tasty red snapper in stores in eight states were other species. How much of the mislabeling was unintentional or fraud is unknown, said Dr. Peter B. Marko, assistant professor of marine sciences at UNC's College of Arts and Sciences. "Red snapper is the most sought-after snapp...

Structure solved at Scripps shows how one human protein reduces potency of chemotherapy

...lls by damaging their DNA. DNA, the molecule that stores our genetic information, is composed of two intertwining helical strands that bind to each other through base pairing. Each strand is composed of four types of DNA bases (A, G, C, and T) attached to one another through a sugar-phosphate backbone. The...

Measuring blood sugar with a wave of the arm

...e same theory behind plastic security tags used in stores to prevent shoplifting. The device, which will be described in the July 15 edition of Analytical Chemistry , a peer-reviewed journal of the American Chemical Society, the world's largest scientific society, also shows promise for monitoring environm...

Gestational diabetes not found to alter the metabolic processes in obese pregnant women

...petite and increase energy expenditure as body fat stores increase) concentrations in pregnancy has not yet been fully explained, the research team examined the relationship of maternal serum leptin changes in nutrient metabolism. The authors of the study, Longitudinal Changes in Energy Expenditure and Body...

Natural, man-made mix promises biggest landscape plant growth

At warehouse-sized stores this season, consumers scan pallet-laden shelves for just the right concoction. Various formulas promise new vigor, add iron or correct a myriad of deficiencies. Fast-acting or slow-release, organic or not, everything promises to get bigger and las...

'Rolling Store' provides model for overcoming barriers to healthy foods and better health outcomes

...he poor in this area relies heavily on convenience stores for food purchases. Researchers at the Pennington Biomedical Research Center in Baton Rouge, Louisiana, and the Agricultural Research Service, USDA, in Little Rock, Arkansas, created a six month pilot project to examine the impact of the av...

Researchers establish first molecular link between eating and aging

...in a single protein that controls whether a mammal stores fat or sheds it. The work could lead to drugs tha...tein and carbohydrates in its food immediately; it stores fat in special cells called white adipose tissue (WAT). When it reduces its caloric intake, the WAT ...

Loyola decides to test new blood substitute in trauma patients at the scene of injury

... distributing flyers in schools, churches, grocery stores and public health centers. Loyola is one of 20 Level I trauma centers participating in the trial nationwide and the only one in Illinois. "If the blood substitute works the way we hope it will, it could be the first major advance since the introduc...

Only half of recalled meat and poultry is recovered, study finds

... follow-up. If a product is already in the grocery stores and the stores don't put up big signs about the potential hazard, people might not get the message." But simply all...

New studies show Curves Program raises metabolic rate in overweight and sedentary women

...protects muscle, which leads to the burning of fat stores and the ability to eat a healthy amount of food." Heavin holds a degree in Health and Nutrition Counseling and is the author of The New York Times Best-Sellers Curves: Permanent Results Without Permanent Dieting and Curves On the Go. Kreider sa...

Mantis shrimp may have swiftest kick in the animal kingdom

...as a spring, the UC Berkeley researchers found. It stores energy until a quick release propels the shrimp's club in a shell-crushing blow. "We know of no other biological example where this saddle-shaped structure is used as a spring," Patek said. Mantis shrimp are distant relatives of the shrimp and lobste...

Moderate iron deficiency affects cognitive performance - but iron supplementation improves it

...upplementation and the subsequent increase in iron stores markedly improved cognition scores (memory, attention, and learning tasks) and time to complete the task. This finding has great implications, says Dr. Murray-Kolb, because the prevalence of iron deficiency remains at 9 percent to 11 percent for wom...

Newborn lambs' central heating system could aid fat busting in humans

...ge London scientists. Unlike normal white fat that stores surplus energy, brown fat generates heat in response to cold or excess caloric intake. While some mammals such as rodents maintain this 'good' fat throughout life, humans are similar to lambs: brown fat is present in the newborn to act as an internal...

NJIT chemists pave way for cheap, usable field test for polluted, toxic, water, air, food

... cheap, throw-away sensor--just like the ones drug stores now sell for early pregnancy tests--and quickly learn if a toxic chemical is in the air, food or water. Mitra will deliver his data at the American Chemical Society's 227th national meeting in Anaheim, CA, March 31, 2004 at 9:15 a.m. PST (12:15 p...

1 2 3 4 5

(Date:11/24/2014)... (PRWEB) November 24, 2014 Global ... 6.19 billion by 2020, according to a new ... rates of cardiac arrhythmias clubbed with growing global ... this market. Though still in the budding stage, ... rise in usage rates in the recent times, ...
(Date:11/24/2014)... 2014 Residents of retirement communities in ... year’s SENIORS GOT TALENT, an annual online talent competition ... players to classic crooners, to seniors partying on a ... are indeed living young. , “SENIORS GOT TALENT, while ... cash prize, has always been about highlighting the vibrancy ...
(Date:11/24/2014)... York (PRWEB) November 24, 2014 The ... by the Family and Children's Association to ... as soap, shampoo, mouthwash and other such items.The Association's ... who are home bound, living in nursing homes, assisted ... to greatly enhance the well being of seniors throughout ...
(Date:11/24/2014)... SafeHandles™ announced that they will be featured ... Jr, airing via Discovery Channel. Dates and show times ... non-invasive, replaceable, and affordable germ protective device. This segment ... and adhesives to promote hand hygiene in high traffic ... SafeHandles is the desire to make a positive impact ...
(Date:11/24/2014)... Pittsburgh, PA (PRWEB) November 24, 2014 ... as he was trying to cross the street in ... "The driver never saw him. I came up with ... easily visible at night." , He developed the Safety ... night or in low-lighting conditions. The device ensures that ...
Breaking Medicine News(10 mins):Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 2Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 3Health News:Electrophysiology Devices Market Worth Forecasted To Reach $6.19 Billion By 2020: Grand View Research, Inc. 4Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 2Health News:Nursing Homes & Assisted Living Retirement Communities Enter Seniors Guide's Seniors Got Talent 3Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 2Health News:The Holiday Inn Westbury - Long Island gives back to the local Long Island community, and also goes beyond borders to assist those in need during the 2014 Holiday Season 3Health News:New Episode of Innovations TV Series to Feature SafeHandles™ 2
Other Tags
interactivemucolipidosisregularlyace2elbowtenniscushingpituitaryusgsagigrapefruitreleasewishespacemakerafghanistanreturning