Tag: "sustain" at biology news

Genetically engineered foods: science and nature don't necessarily mix

...h Each year, approximately 13.2 million workers sustain non-fatal injuries, such as low-back pain and fracture, according to the Bureau of Labor Statistics, and 862,000 suffer from work-related illnesses - at a cost of $171 billion. Industry leaders are beginning to look for alternative methods to stem t...

UC Davis researchers were key to Clinton's order for marine reserves

... or all human activities to conserve biodiversity, sustain fisheries, preserve cultural and recreational resources, and to provide valuable natural laboratories for scientific research. Currently, less than one one-thousandth of U.S. marine waters are fully protected from harm. One of the key recommendations...

Endangered butterfly needs proper habitat, special nectar

...enough Kincaid's lupine, the larval host plant, to sustain the butterfly. However two of the four experimental treatments did produce enough nectar in 1999 from the flowering plants that she planted in 1995. At NCEAS Schultz is part of a working group studying the effect of landscape context on restoration...

Honey : Natures's sweetener may increase recuperation after workouts

...oney-protein combinations also seem well suited to sustain favorable blood sugar concentrations after training."...

Do fish farms really add to the world's supply of fish?

...ole in feeding a hungry planet. But if it wants to sustain its positive contribution to the world's supply of...just want the industry to be more careful and help sustain the resource we're all dependent on."...

Ancient mediterranean port city may have been holy land way station

...pparently gathered enough rainwater in cisterns to sustain them, Hohlfelder said. Aperlae likely was founded...ted sufficient water from the 32 known cisterns to sustain a city the size of Aperlae deepened this summer when two public baths were discovered. "These publ...

Faulty practices threaten condor program

...death rate of released birds has been too great to sustain a wild population. Part of the problem is that birds raised using puppet condors have been excessively tame, despite efforts to train these birds to avoid humans and human structures. One group of eight birds wound up in a resident1s bedroom after...

Taking the pulse of giants: Detecting change and its consequences in western mountain ecosystems

...the researchers, is to manage land use in order to sustain the ecosystem qualities that are attracting newcomers and stimulating the new economic expansion. Daniel Fagre (USGS) will conclude the symposium with a presentation entitled, "Taking the Pulse of Mountains: Research and Monitoring Networks." Al...

Zirconate material will improve plutonium storage safety

... in less than 1,000 years. The zirconate will not sustain damage for periods up to 30 million years. Consid...esults from the decay of plutonium. The ability to sustain high levels of damage without a disruption of the atomic structure accounts for the radiation stabil...

Rice research another step forward for green revolution

...There's evidence and good reason to believe we can sustain these results," Mundt said. "Scientists will also continue to develop new, blast-resistant varieties of rice that should further assist with this approach of crop diversification. This should clearly be good for the environment, good for rice farmers...

Improvement in controlling agricultural runoff still needed to prevent ecological disasters

...n a green house on campus. The research estuaries sustain fish and shrimp, and marsh plant populations so that the impact of agricultural runoff and strategies and treatments can be evaluated. Measurements from both nonplasticulture fields and plastic-covered fields were also part of the study. The resear...

Animals regulate their numbers by own population density

... their reproduction, and that was done in order to sustain their own survival. When conditions were better, t...ter. They believe that the types of food needed to sustain certain types of body fat throughout the winter were insufficient for the dense populations....

University of Pittsburgh reports best gene delivery to date of protein missing in Duchenne Muscular Dystrophy

... are compromised to the point where they no longer sustain life. This news moves us one step closer to a cure and for now provides real hope to further help these boys, said Ms. Pat Furlong, president of the Parent Project for Muscular Dystrophy Inc., which provided partial funding for this research. Central...

Insects caught in a nutrient-poor food web

...t be presenting those nutrients at levels that can sustain you. Such an organism would suffer from severe food quality problems, and therefore not be evolutionarily feasible. These findings could also have important implications for agriculture. Farmers fertilizing their crops get the benefit of producing n...

Florida research shows that for rice, warmer earth brings uncertain future

...ind some evidence that the tropical cultivar could sustain reproductive ability at the highest temperature, but it didn't, which is bad news," said Alison Snyder, a UF graduate student who worked on the study for her masters thesis. Indeed, the temperature cycles used in the experiment closely track scienti...

Scientists isolate premature ovarian failure gene

...h. But usually a woman is born with enough eggs to sustain fertility for several decades of her adult life. ...and may have fewer egg follicles than necessary to sustain a normal reproductive lifespan. Although we are talking about an age-related condition, menopaus...

Microbial activity key component of global environmental change

...microbial populations and activities be managed to sustain the biosphere and its diverse life forms while promoting human welfare?...

Scientific theory of marine reserves to be released

...ms, a local population within a reserve could both sustain itself and provide substantial export to nearby non-reserve areas. Thus all stakeholders could be served by a common design for a system of marine reserves. According to Gaines, the effects of oil spills, toxic run-offs, large storms and disease ou...

Analysis of flight performance in wandering albatrosses yields insights into foraging patterns of different ages and sexes

...th would be likely to encounter winds too light to sustain efficient soaring flight. But a female wandering albatross would not necessarily be at a disadvantage in the higher winds to the south where the males typically forage, Shaffer noted. "It may be that the sexes forage in different places to avoid com...

Krauss book explores universe from oxygen atom's perspective

...llions of years for living organisms to be able to sustain life in an oxygen environment, and remarkably it is precisely these organisms that helped create the oxygen atmosphere we now breathe today. Early life forms of bacteria and slime-like organisms continue to exist even today deep within the oceans ne...

1 2 3 4 5 6 7 8

(Date:7/24/2014)... IL (PRWEB) July 24, 2014 In a ... infertility expert and founder of Lotus Blossom Consulting LLC ... Rosato entitled Three Ways to Cut the High Cost ... way to minimize costs is to maximize your chance of ... advice on choosing a clinic. , “I am always ...
(Date:7/24/2014)... the risk for head and neck cancer (HNC). Evidence suggests ... the risk of HNC in patients with DM has not ... sixth most common type of cancer. It accounts for about ... new cancer cases and 350,000 cancer deaths worldwide each year. ... to examine the risk of HNC in patients with DM. ...
(Date:7/24/2014)... Kan. (PRWEB) July 24, 2014 ... announces that it has achieved certification for compliance ... tested and verified by the DoD Information Assurance ... Vendor Neutral Archive, identified within the DoD as ... Authority to Operate designation from the U.S. Army ...
(Date:7/24/2014)... Hospital and the University of Tennessee Health Science Center ... drug shown to safely reduce the viral load and ... respiratory syncytial virus (RSV). RSV is the most common ... in the United States and worldwide. , The ... John DeVincenzo, MD. DeVincenzo,s Le Bonheur lab has been ...
(Date:7/24/2014)... Moines, IA (PRWEB) July 24, 2014 Members ... keep Michael Wolnerman, RPh, CCIM, Senior Associate of Sales at ... the Governor appointed him to the Board and that his ... , “I want to provide the best I can for ... believe I am uniquely positioned to provide a special insight ...
Breaking Medicine News(10 mins):Health News:Mindy Berkson, Infertility Expert and Founder, Lotus Blossom Consulting LLC: Leading the Pathway to Parenthood 2Health News:Mindy Berkson, Infertility Expert and Founder, Lotus Blossom Consulting LLC: Leading the Pathway to Parenthood 3Health News:Perceptive Software Achieves DIACAP Certification for Vendor Neutral Archive Solution to Support U.S. Department of Defense Integrated Clinical Systems Program 2Health News:Perceptive Software Achieves DIACAP Certification for Vendor Neutral Archive Solution to Support U.S. Department of Defense Integrated Clinical Systems Program 3Health News:Perceptive Software Achieves DIACAP Certification for Vendor Neutral Archive Solution to Support U.S. Department of Defense Integrated Clinical Systems Program 4Health News:RSV research breakthrough to help infected children 2Health News:Wolnerman Re-elected as Chairperson of Iowa State Board of Health 2
Other Tags
gravitationalelongatefeetclamriboswitchespeeksgenesystemsstrepcommunicationstronglyyouthsvaccinatingsurgeplanningmyeloidpotency