Tag: "sustain" at biology news

Georgetown researchers achieve increased cancer patient survival

...ability of our prime-boost products to trigger and sustain powerful anti-cancer immune responses. Based on t...col, the two products are designed to generate and sustain a therapeutic level of cytotoxic T cell activity critical for destruction of cancer cells. In addit...

Study offers insights into evolutionary origins of life

...hat possesses some of the key properties needed to sustain life in such a world. The new ribozyme, ...could have had the ability to replicate itself and sustain life in early evolution, before the advent of DNA and proteins. The findings will ultimately help ev...

Soil fertility limits forests capacity to absorb excess CO2.

...forest response to atmospheric CO2. "Trees can sustain increases in biomass only as long as they find enough water and nutrients in their ecosystems," Ellsworth said. "I don't think we can assume existing forests, with their fertility limitations, will completely offset rising CO2 without soil amendment...

Amazon rainforest could be unsustainable within a decade

...push the rainforests past the point where they can sustain themselves a lot sooner than many people think. The other key tropical rainforests are in the Congo River Basin in Africa and Southeast Asia. To use the two-million-square-mile Amazon River Basin as an example, Alcock said his model shows that if...

Scientists find genetic basis of insect's resistance to engineered crops

...tions to the high-dose/refuge strategy, that could sustain use of Bt-transgenics and prolong the environmental benefits they bring by reducing the use of conventional insecticides."...

Vaccination following spinal cord injury: Innovative Weizmann Institute approach limits paralysis

...e United States alone, approximately 10,000 people sustain a spinal cord injury each year. More than half of these injuries are classified as incomplete, or partial, meaning that some nerve fibers survived the initial trauma. If the surviving tissue could be protected against secondary degeneration, this wou...

UNC scientists develop new way to calculate stability of proteins

...ction of a protein depends on the fact that it can sustain the same structure over an extended period of time," Carter said. "Thus, for purposes of drug design, the whole area of protein engineering is highly dependent on knowing the contributing factors that make a protein stable." Getting to know a prote...

Can we defy nature's end?

...ate that protecting enough biological diversity to sustain a healthy planet will cost some $30 billion, and maintain that the money and measures to do so are attainable. Their findings appear in, "Can We Defy Natures End?," an article published in todays Science Magazine. The article summarizes the practica...

Honey shines in athletic research, has scientific community abuzz

...honey sweetened "muscle shake" was the only one to sustain blood sugar over the two hours following the exercise. The final trial focused on nine competitive cyclists who were given a honey, glucose or placebo gel prior to and at 10-mile intervals of a simulated 40-mile race. Honey significantly increas...

Blood vessels trigger development of the pancreas

...nsure that they receive the proper blood supply to sustain growth. Now, researchers have discovered that blood vessels themselves can send signals to the pancreas that trigger its development. The finding provides the first glimpse of a new type of biochemical signaling pathway that may prevent the pancreas,...

NSF awards $55 million in grants to study biocomplexity in the environment

...hnology effectively to observe the environment and sustain the diversity of life on earth. Scientists, engineers, and educators must work in teams across diverse fields, says Colwell, that go well beyond biology to include, for example, physics, systems engineering, mathematics, economics, a...

Yale researchers develop first microarray chip for complete analysis of proteins

...which interacts with other proteins to develop and sustain cell life. Prior to the Yale scientists' discovery, studying proteins on a large, nearly complete scale had never been done, and many scientists believed it was not possible. Snyder, who is also co-director of the recently announced Yale Center of E...

Scientists identify cells necessary for tumor angiogenesis

...roteins, Id1 and Id3, are necessary to support and sustain tumor angiogenesis. In this study, Id-deficient mice were transplanted with bone marrow cells from donor wild-type mice (normal mice) that were marked with a protein (B-galactosidase+), which allows them to turn blue when stained with a specific dye...

Finding life in the solar system: A new synthesis

... is even more reason to think that they could also sustain life. "As a member of the NASA Astrobiology Institute and Director of ASU's Astrobiology Program, I have continually come into contact with wonderfully visionary scientists who are helping expand the horizons of astrobiology," Farmer said. "This has...

Water, sediments in ice-bound antarctic lakes may harbor unique microorganisms, ecosystems

...ottom of Lake Vostok, and in other lakes, may also sustain life. They caution, though, that developing both the technology and the experimental protocols to explore those lakes without contaminating the waters or harming any microbial communities that may exist there will be an extremely complex undertaking ...

Columbia team finds treatment that corrects cellular defect at the root of heart failure

...eloped world, occurs when the heart is too weak to sustain proper circulation. Some patients in heart failure receive left-ventricular assist devices (LVADs), which are implanted in the chest to help pump the blood and give the patient's own heart a rest as he or she waits for a heart transplant. Patients in...

UMass researchers find environment on Earth that mimics Mars geochemically and supports ancient life form

...here is no sunlight. So, if there is life, it must sustain itself with alternative energy sources. This study demonstrates, for the first time, that certain microorganisms can thrive in the absence of sunlight by using hydrogen gas released from deep in the Earths surface as their energy source. Lovley added...

Scientists use llama droppings to help combat water pollution

...en communities of indigenous people to reclaim and sustain the water sources which are currently denied to them by the legacy of large scale mining' he concluded.As a result of his research, Professor Younger and his team have been asked to help the European Commission draft its law on the regulation of poll...

West Nile Virus heading toward Texas

...e temperate Texas climate, however, is expected to sustain mosquitoes, and therefore West Nile, more continually than in northern climates. Texas coastal areas, marshlands and other areas where mosquitoes breed in standing water and thrive are most likely to harbor infected mosquitoes. "West Nile is essen...

The body's production of melatonin may be the reason why the elderly can't get a good night's sleep

...ngs during the sleep episode, and the inability to sustain sleep for the desired duration frequently occurs. As if fitful sleep wasn't bad enough, the elderly are deluged with misinformation inspired by marketing efforts that offer a "cure-all" for the problem. Too often they are told that a melatonin defic...

1 2 3 4 5 6 7 8

(Date:8/22/2014)... (PRWEB) August 22, 2014 A new, online ... connection. The summit is no-cost and open to everyone. ... kept secrets, practical tips and advice on how to stop ... or manage weight. Mindful eating is not a diet. ... stay motivated instead of an "eat this, don't eat that" ...
(Date:8/22/2014)... who need surgery for facial pain caused by trigeminal ... used, reports a study in the September issue of ... Congress of Neurological Surgeons . The journal is ... part of Wolters Kluwer Health . , Percutaneous ... lower cost than other types of surgical treatments for ...
(Date:8/22/2014)... Ticket Down is a reliable source for ... Albuquerque and Rapid City. For fans looking to speak with ... allows just that. Caputo was born and raised in Hicksville, ... knit family who began to see spirits when she was ... had a chance to do what most people wished they ...
(Date:8/22/2014)... 2014 Pirate Jonny's Caribbean ... in providing new recipe cards, fun t-shirts, and caps ... Hailing from Clearwater, Florida, Pirate Jonny, aka, Jonathan Toner, ... with two to three recipes featuring different flavors of ... on the website. The recipe cards will feature ...
(Date:8/22/2014)... According to the new research ... Global Trends & Forecast to 2019" defines and ... forecast of the market value. The isocyanate material ... 2019, at a significant CAGR from 2014 to ... 44 figures spread through 286 pages and in-depth ...
Breaking Medicine News(10 mins):Health News:20 Top Experts Discuss How to Unravel the Food-Mood Connection 2Health News:More common procedures for painful facial tics carry high costs, reports study in Neurosurgery 2Health News:Theresa Caputo Tickets in Kalamazoo at Wings Stadium, Saenger Theatre in New Orleans, Kiva Auditorium in Albuquerque and Rapid City at Don Barnett Arena Now Available 2Health News:Pirate Jonny's Caribbean BBQ Rubs, Seasonings & Sauces Get New Look by Hoisting New Recipe Card Creations and New Clothing Apparel for its Logos 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 2Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 3Health News:Isocyanate Market An Industry Growing Steadily Projected to Grow $38,729 Million by 2019 - Report by MarketsandMarkets 4
Other Tags
circuitrythinkingmapsdeficitdyingdesertcardiometabolicdipregrowparametersmanagesscriptshandfulavertperversitydrills