Tag: "tail" at biology news

Two routes to FAK activation and cancer cell migration

...ty depends on interactions between the cytoplasmic tail of NEP and 2 other cytoplasmic factors that otherwise bind and phosphorylate FAK. This c-Src independent pathway may account for other recent data indicating that catalytically inactive NEP retains some biological activity....

Losing your head

...s. That they were able to make embryos that have a tail instead of a head and trunk represents a dramatic advance in the understanding of vertebrate development....

Human genome analysis hints at new proteins involved in gene expression

...hat encode proteins involved in adding the poly(A) tail to mRNA, the researchers unexpectedly found new genes, which, again, suggests that humans have a more complex gene expression machinery. Green said, "in each case, the surprises are of the same type. When we looked for genes for certain types of pro...

Hopkins' Young Investigators' Day winners shine in the spotlight

... direct the rearrangement into a definite head and tail end of the developing animal. Clifford R. Weiss has shown the potential for magnetic resonance imaging in pinpointing the sort of arterial inflammation associated with atherosclerosis. His work could form a basis for tracking vessel disease thera...

Measuring the muscle: new study by Scripps researchers depicts how the tuna's body is built for speed

...have a more streamlined body and the motion at the tail acts almost like a propeller." Shadwick says the results of the study hold implications for research in comparative physiology and the evolutionary biology of fishes. The results also could be important for the design of robotic, self-propelled aut...

Sex lives of wild fish: Genetic techniques provide new insights

...n with while the guardian male waits, fanning his tail to aerate the eggs, protecting the nest from predators and hoping to entice another female to add more eggs to the nest. There's also a problem with other males. "Occasionally a second male will join the spawning pair and attempt to 'steal' fertili...

First dinosaur found with its body covering intact; displays primitive feathers from head to toe

...lion-year-old fossil dinosaur covered from head to tail with downy fluff and primitive feathers. It is th...keleton resembles that of a large duck with a long tail and an oversized head (indicating that the animal was a juvenile). A small fish is embedded in the ...

Researchers use cloning technology to produce embryonic stem cell lines from adult mice

...n mice," says Mombaerts. "Starting with a harmless tail biopsy of an adult mouse, we have shown that we can produce an essentially unlimited supply of highly differentiated cells with potential therapeutic interest. Importantly, the overall efficiency of this sequence of manipulations is quite good: the p...

Gulp! URI professor studies how sharks eat

...al research, Wilga showed that the sharks body and tail provides the lift not the long suspected fins, which are actually used for steering. Highly successful predators, sharks have been around for about 450 million years. There are about 800 species of sharks worldwide, including rays and skates that are...

Structural studies reveal how potassium channels are inactivated

...he first ten amino acids of the N-terminal peptide tail were also hydrophobic, and the next ten were hydro...hydrophilic ones, the scientists reasoned that the tail would naturally fit into the pore if it extended deep into the pores interior. To test this hypothe...

DNA analysis of salamanders turns up new species under almost every log, UC Berkeley zoologists find

...re general salamander body plan characterized by a tail about the same length as the body. "We were so sur...ng from 14 to 18-22 vertebrae between the head and tail -Lineatriton kept the same number, 14, but grew them longer. Both have tails that stretch nearly twi...

Benefits from Alzheimer's plaque-producing reaction? Science study proposes role in gene expression

...ward Hughes Medical Institute propose that the APP tail enters the nucleus and participates in gene expres...e cell. Sdhof and Cao investigated whether the APP tail might do the same. Transcription requires a complex assortment of molecular machinery to unzip the...

UNC study pinpoints gene crucial for female embryo survival

...ls where to go in the embryo - to make head versus tail versus gut. Without this gene functioning in the proper way, those cells move to the wrong place. And that can result in birth defects. "We've learned from the human genome projects that there are far fewer genes than were originally estimated, roug...

PNNL captures picture of fish passage with acoustic camera

...dual fish's undulating movements, and its head and tail were visible, even at distances of 30 feet. Evaluations were done at the U.S. Army Corps of Engineers' The Dalles Dam, a 2,089-foot-wide structure straddling the Columbia River between Washington and Oregon. Scientists at the University of Washingto...

Mechanism believed found that regulates movement within cells

...ory protein, they say, determines if a part of the tail of a larger motor protein binds to a pigment, allo...frog (Xenopus), but the evidence suggests that the tail phosphorylation may be common in many other cells.We want to believe that what we have found is a un...

Gene therapy may be a tool to prevent blindness

...erent genes that were separately injected into the tail veins or eyes of the animals reduced new blood ves...a synthetic viral carrier and injected it into the tail veins of mice. The mice were then given a laser treatment that causes abnormal blood vessels to gro...

Molecular motor packs DNA into viruses at greater than champagne pressures, researchers report

...s a rotating motor, like the motor that powers the tail or flagellum of some bacteria. "The motor, consisting of a 10-nanometer diameter ring of RNA molecules sandwiched between two protein rings, is very intriguing and different from other motors that have been studied," said Douglas Smith. "We suspect t...

Science Report: Super-crocodile crawls out of the African Cretaceous

...The giant crocodilian was covered from head to mid tail in an overlapping armor of scutes (bony plates embedded in the skin), each sporting annual growth rings that the researchers used to estimate the age of a given animal. Thin sections from scutes, taken from a fossil individual that had reached about...

Cells from human umbilical cord blood help rats recover from stroke faster, new study finds

...ion of cells from cord blood was injected into the tail veins of rats previously induced to have symptoms of stroke. The rats showed improvement in movement, balance and reflex responses even when treatment with cord blood cells was begun a week after the onset of the stroke. However, the greatest recov...

Stanford scientists to probe inner workings of remarkable microbe

...ls - a small ``swarmer`` cell equipped with a tiny tail that allows it to swim, and a larger ``stalk`` cell shaped like a lollipop on a stick. In fact, ``caulo`` is Latin for ``stalk.`` ``Asymmetrical division is a fundamental biological process,`` McAdams said. ``Without it, we`d turn out to be blobs wit...

1 2 3 4 5 6 7

(Date:11/22/2014)... 23, 2014 BambooFlooringChina.com is a ... has proudly released its new collection of bamboo mats ... up to 29% off. , According to the ... tree-like grass, making it a highly renewable resource. Their bamboo ... a mixing color which comes from natural bamboo with caramel ...
(Date:11/22/2014)... Setria® Glutathione is now available ... for use “as a therapeutically active ingredient in ... Therapeutic Goods (Listing) Notice 2014 (No. 5) - ... Glutathione will be exclusivity distributed in Australia by ... imports fine chemicals to Australian manufacturers. TGA approval ...
(Date:11/22/2014)... (PRWEB) November 22, 2014 Discount-Dress.com ... aim of the firm is to increase the company’s online ... introduced a new selection of bridesmaid dresses and announced a ... offer is valid until Dec. 30, 2014. All the dresses ... also inexpensive. , In fact, Discount-Dress.com is very good ...
(Date:11/22/2014)... Nocturia is defined by the International ... individual has to wake at night one or ... Pipeline Review, H2 2014” provides comprehensive information on ... analysis at various stages, therapeutics assessment by drug ... (RoA) and molecule type, along with latest updates, ...
(Date:11/22/2014)... A petition seeking a ban on ... in minimally-invasive hysterectomies and fibroid removal surgeries has gained ... October, Bernstein Liebhard LLP reports. According to Change.org, ... 21st, 2014. That represents an increase of 456 signatures ... to the campaign.* , The campaign to ban uterine ...
Breaking Medicine News(10 mins):Health News:Trendy Bamboo Mats Online Now By BambooFlooringChina.com 2Health News:Setria® Glutathione Now Available in Australia 2Health News:Setria® Glutathione Now Available in Australia 3Health News:Bridesmaid Dresses Introduced by Famous Company Discount-Dress.com For The New Year 2015 2Health News:Nocturia Therapeutic Pipeline Market Review by Drugs and Companies H2 2014 Report at RnRMarketResearch.com 2Health News:Nocturia Therapeutic Pipeline Market Review by Drugs and Companies H2 2014 Report at RnRMarketResearch.com 3Health News:Nocturia Therapeutic Pipeline Market Review by Drugs and Companies H2 2014 Report at RnRMarketResearch.com 4Health News:Power Morcellator Petition Gains More than 450 Signatures Since October, Bernstein Liebhard LLP Reports 2Health News:Power Morcellator Petition Gains More than 450 Signatures Since October, Bernstein Liebhard LLP Reports 3Health News:Power Morcellator Petition Gains More than 450 Signatures Since October, Bernstein Liebhard LLP Reports 4
Other Tags
bloomduecorpsesmellyvalvesimplifyarisingschrenkinsurancecirrhosiscelecoxibtooculpritfindresearchersstanford