Tag: "thanks" at biology news

Vanderbilt students take HHMI fellowships

..."I'm eager to start the program, and I owe so much thanks to Vanderbilt," Peacock said. "I've had so many tremendous opportunities here and so much support from the faculty, especially Dr. Simon Hayward and Dean Miller." Weinberg will be involved with clinical trials for patients with NSCLC and her study w...

Brain control

...st high-tech unmanned undersea vehicle would envy, thanks to a region of the brain that allows our bodies to carry out complex maneuvers. The Office of Naval Research, which traditionally relies on the power of the human mind to achieve breakthroughs in science and technology, now also is harnessing the wor...

HIV takes cellular opportunities to aid infection

...a target cell and begins its process of infection, thanks to a technique created by researchers at the Salk Institute. The technique allows scientists to observe for the first time the steps taken by viruses like HIV after they enter a cell. The study was done with a chicken virus that was modified to cont...

New standard to help diagnose heart attacks

...g heart attacks will become a more precise science thanks to the first of a new series of clinical standards just issued by the National Institute of Standards and Technology (NIST). Standard Reference Material (SRM) 2921 (human cardiac troponin complex) will help manufacturers develop and calibrate assays ...

JGI, VBI help unravel sudden oak death & soybean disease

...her responsible for a devastating soybean disease, thanks to the DNA sequence produced by the U.S. Department of Energy (DOE) Joint Genome Institute (JGI), in collaboration with the Virginia Bioinformatics Institute (VBI). The projects received nearly $4 million in support from the U.S. Department of Agricu...

Whole body imaging allows better understanding of the immune system

...f immune response to use with humans. He says that thanks to collaboration between clinicians and scientists from a wide variety of disciplines, the time may not be that far away. Speaking June 15 at the annual meeting of the American Society for Biochemistry and Molecular Biology (ASBMB)/8th Inter...

Assisted reproduction can't compensate for waiting too long to start a family

...another three will do so during the next two years thanks to ART and six will remain childless. Out of 100 s... will have a child after three years, another four thanks to ART and 14 will remain childless. Out of 100 starting at age 40, 57 will have a baby after two ye...

Finding the hole in the defenses of cavity-creating microbes

...t they adapt to the acidic environment and thrive, thanks to the special defenses they use. Not only that, but the acid they produce harms other bacteria, allowing S. mutans to dominate. We're trying to make the human mouth, the only hospitable environment that S. mutans has ever found, inhospitable." S. m...

Early predictor of breast cancer aggressiveness

...decisions on the best treatment for breast cancer, thanks to research published in Breast Cancer Research today. A gene involved in the adhesion of cells is less active in breast tumors with a poor prognosis than those that are less aggressive, researchers found. Measuring the activity of the ALCAM gene in...

Measuring blood sugar with a wave of the arm

... waving goodbye to the pain and hassle of needles, thanks to a new under-skin sensor that monitors blood sugar levels with a simple wave of the arm. The sensor, which is smaller than a dime and paper thin, is based on the same theory behind plastic security tags used in stores to prevent shoplifting. The de...

LSU researcher discovers new bird

...omething new. Something different. Now, thanks to Lane, a specimen of that bird previously unknown to science rests in a Lima museum and it will soon bear a name of Lane's choosing. As the discoverer of what could be a new species or, perhaps, a new genus, Lane will also be the first to author ...

How wounds heal Clues from flies

...ngs of wound healing a high research priority. And thanks to the powerful system presented here, this task should be all the easier....

Ottawa's leadership in biomedical and health research has paid off

...Canada is one of the world's top research nations, thanks to Ottawa's commitment to research and leadership ...he CFI. "This transformation is happening rapidly thanks to the partnership approach and cooperation of all of those involved in the research enterprise. To...

Nevada researcher re-ignites mammal reproduction debate

...n evolutionary biology received new support today, thanks to a study by a scientist at the University of Nevada, Reno. Elissa Cameron, a mammal ecologist in the Department of Natural Resources and Environmental Science, has helped to disprove critics of a scientific theory developed in 1973. At that time,...

Computer database being developed at Temple will allow for better inventory of chemicals

... and countless man-hours to complete. But now, thanks to virologist Jay Rappaport, Ph.D., an AIDS researcher in Temples Center for Neurovirology and Cancer Biology, the task may soon get much easier. Rappaport, who chairs the Universitys bio-safety committee, has developed a prototype database and s...

Chernobyl study: Risk of thyroid cancer rises with radiation dose

...re one in terms of negotiations," Davis said. But, thanks to efforts by Fred Hutchinson's then-president and director, Robert W. Day, M.D., and by the late Adm. Elmo Zumwalt, a former center trustee and former chief of naval operations for the U.S. Navy, new relationships were established. In 1992, a resear...

Maine-based biophysics institute gets funding for first US-based 4Pi nanoscale microscope

...rument is now coming to the United States in 2005, thanks to a $732,624 National Science Foundation grant to a Maine interdisciplinary biophysical research program. The Institute for Molecular Biophysics brings together expertise in biophysics and engineering at the University of Maine in Orono, molecula...

Cockroach-like robot leads new research effort

...rawlita, which bounces five body lengths at a time thanks to six piston-driven legs. But, he admits, a biologist and an engineer can go only so far in understanding locomotion without the help of mathematicians and specialists in dynamics who can create models that can be tested on animals and robots...

$2.7 million grant to support creation of virtual zebrafish atlas

... tropical fish will enjoy improved global exposure thanks to a five-year, $2.7 million grant from the National Center for Research Resources-National Institutes of Health (NIH) awarded to Keith Cheng, M.D., Ph.D., associate professor of pathology, Penn State College of Medicine. The grant will support the c...

1 2 3 4 5 6 7 8 9 10

(Date:6/29/2015)... (PRWEB) , ... June 29, 2015 , ... ... recognized by the independent auditor of customer service for the 40-center nursing home ... than 1,100 skilled nursing centers in the United States in one or more ...
(Date:6/29/2015)... ... June 29, 2015 , ... ... filed against C.R. Bard, Inc. and Ethicon, Inc. continue to move forward ... next Case Management Conference is to be convened on Thursday, July 23rd at ...
(Date:6/29/2015)... ... ... USA Today reported on June 18th the overdose death rate has ... rest of the nation’s growing overdose death rates in 26 other states the U.S. ... stop the increasing overdose trend from continuing: , , Encourage and ...
(Date:6/29/2015)... ... June 29, 2015 , ... The world’s fastest and ... Aviation Museum to the Science Museum of Virginia. This iconic, supersonic stealth plane will ... , “Suspending a supersonic jet from the ceiling of a historic train station is ...
(Date:6/29/2015)... ... ... The Food Safety and Technology Research Centre under the ... (PolyU) has developed a new method for rapid authentication of edible oils and ... in food safety, and becomes particularly important with the emergence and widespread use ...
Breaking Medicine News(10 mins):Health News:National HealthCare Centers Receive 'Customer Experience Awards' 2Health News:National HealthCare Centers Receive 'Customer Experience Awards' 3Health News:National HealthCare Centers Receive 'Customer Experience Awards' 4Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 2Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 3Health News:Transvaginal Mesh Lawsuit News: New Jersey Court Overseeing Thousands of Ethicon, C.R. Bard Pelvic Mesh Claims Schedules July Conference 4Health News:Overdose Death Rates Decreased in Florida as of 2015 2Health News:Overdose Death Rates Decreased in Florida as of 2015 3Health News:SR-71 Prepares for Flight to Science Museum of Virginia 2Health News:PolyU develops a new method for rapid authentication of edible oils and screening of gutter oils 2
Other Tags
europainappropriatecharacterizationingeniumbecamealaskainertreactattemptinterviewingmotivationalexaminingelephantiasisclarifyingvolmanifesto