Tag: "towards" at biology news

Trial shows which brain cancer patients benefit from temozolomide

...an become a targeted treatment. It is a first step towards molecular diagnostics. In the future, biopsy material optimally conserved for molecular testing should be collected for all patients as a routine diagnostic procedure." It also meant, she added, that for patients without methylation, future cli...

16 APS exercise research highlights, from reduced flu mortality to proteomics & obesity

...scle power and metabolic capacity in COPD patients towards sedentary control levels, yet even during isolated small muscle mass exercise, provide evidence of attenuated muscle plasticity associated with COPD. 36.6 Dustin Hittel, et al. (Children's National Medical Center, Washington, D.C.) Using genomic a...

USAID, Conservation International & Starbucks launch Conservation Coffee Alliance in Central America

...an Government and conservation community's efforts towards sustainable development," said Adolfo Franco, administrator for Latin America, U.S. Agency for International Development. "Since then, USAID's commitment to conservation and social welfare has grown stronger. USAID is proud to support the Starbucks ...

Wastewater could treat itself, power city

...able energy source in the future. "We're moving towards a future where we see our wastewaters and other wastes as resources," says Bagley. "If electricity costs go up, like they have in places like California, this could be a cost-effective and renewable energy source." ...

Maine-based biophysics institute gets funding for first US-based 4Pi nanoscale microscope

...les to the IMB for analysis. "I see biology moving towards specialized high-tech centers like the IMB, bringing in investigators from all over the world," he said....

Second call for proposals for the European Young Investigator Award

...rs from all scientific disciplines and is directed towards researchers from anywhere in the world. Each award will last for a five-year period and will include the salary of the award holder and funding for an independent junior research group (including two or three staff positions for doctoral students or ...

Genetic map of important tree genes outlined

...nt species. "This is an important fundamental step towards doing the type of genetic and biotechnology research with trees that we've been able to do with only the most scientifically well-known plants," said Steven Strauss, a professor of forest science at Oregon State University. Strauss is one of the co-a...

How do you mend a broken heart?

...hat "as a team we will be able to move much faster towards applying our collective understanding of adult progenitor cell biology to effective human cardiac repair." The five-year grant is from the Fondation Leducq, a non-profit foundation committed to improving health through international efforts to combat...

Protemix corporation announces discovery of way to repair hearts damaged by diabetes

...aszarin TM , brought about a significant reduction towards normal heart size in diabetic patients with cardiac enlargement. Diabetes is often accompanied by enlargement and dysfunction of the heart and coronary heart disease and these are major causes of death2. According to the World Health Organisation, o...

What actually influences air pollution over the Indian Ocean?

...upper troposphere, where they are then transported towards the Mediterranean. The junior research group of the Department of Atmospheric Chemistry has developed the technique of "chemical weather forecasting", that is, predicting the day-to-day changes in the concentrations of gases like ozone and carbon mon...

Evidence for the impact of climate change on deep-sea biodiversity

...sea biodiversity. This study provides new elements towards a better understanding of the potential large-scale consequences of climate change....

Gene duplication allowed pigs to have more babies

..., the multi-disciplinary analysis does go some way towards explaining why natural selection would have favoured pigs with multiple aromatase genes. Dr Benner writes: "Natural history offers biological chemists the opportunity to place broad biological meaning on the detailed analysis of the changing structu...

Alcohol-use and depression among pregnant and postpartum women

...lopment deficits and have fewer resources directed towards their care. Thus, identifying women at risk for these conditions can benefit both the mother and child." Researchers examined data collected from an ongoing, longitudinal study of pregnancy outcomes, the Maternal Health Practices and Child Developm...

Scientists identify compounds that mimic calorie restriction

...in the bar codes included those that have activity towards receptors of interest to the pharmaceutical industry. The receptors include those that are targeted by drugs used to treat high cholesterol and triglyceride levels. One of the receptors, called PPARalpha, is a target for drugs that are currently used...

New prostate cancer gene identified

...ne allows us the opportunity to explore a new path towards treating a significant number of men with advanced prostate cancer. As TGen's mission is to translate laboratory findings into the clinic, we hope to use this information to ultimately help provide prostate cancer patients more treatment options and...

Study explains spatial orientation differences between sexes

...between the sexes, with women tending to look more towards their feet. However, although women are more likely than males to misjudge what is horizontal when performing tasks in sensory-deprived or biased environments, they may have an advantage over men while performing tasks under other sensory conditions,...

In search of a lean gene

...agues at Academia Sinica took a different approach towards the obesity epidemic, analyzing the effects of C/EBP gene replacement in mice. The C/EBP protein family consists of 5 members, 3 of which (alpha, beta, and delta) have established roles in promoting adipogenesis (fat cell differentiation). The resear...

Forest fire sensor inspired by nature

...he University of Bonn have taken an important step towards this goal. They have constructed a forest fire sensor which could be produced more cheaply than commercially available infrared detectors, although it is not yet as sensitive. In identifying a principle of measurement previously unknown in nature and...

New paper in Science introduces revolutionary new paradigm for fishery management

...s depend upon healthy marine ecosystems." Movement towards ecosystem-based approaches has been recommended by the Pew Oceans Commission in 2003, in the recently released draft report of the U.S. Commission on Ocean Policy, and in a number of international arenas. Some elements of the approach are already bei...

European researchers tackle mitosis

...e, each of whom is contributing an essential piece towards a common goal - understanding mitosis."...

1 2 3 4 5 6 7 8 9 10

(Date:10/25/2014)... -- Researchers who discovered antibiotics in farmed and ... concern. The use of antibiotics in animals, ... contribute to the development of antibiotic-resistant bacteria that ... the study. Each year in the United ... and kill about 23,000, according to the Infectious ...
(Date:10/22/2014)... 2014 At a time when the ... and athletes at all levels, the UPMC Sports ... current discussion where two powerful messages are lost: Concussions ... result in full recoveries every day. , In striving ... fact and research, UPMC and the Concussion Program are ...
(Date:10/22/2014)... 22, 2014 For Dr. Iris Hunter, a ... it’s an extension of her life’s mission. Her extensive experience ... the owner of FirstLight HomeCare, make it clear that Hunter’s ... me that my work makes a difference in the lives ... spirit, so after much research, I felt ready to start ...
(Date:10/22/2014)... October 22, 2014 Hay House is pleased ... Addiction and Upgrade Your Life (Paperback; $10.82) written by the ... & Recovery. This book is meant to help readers ... life of recovery. , Recovery 2.0 is not the ... Recovery 2.0 is a guide for what comes next. ...
(Date:10/22/2014)... Losing Weight Your Body’s Way , In ... in the face, it certainly can be difficult to choose ... an extra favor by doing it the healthy way? Set ... listen to your body, exercise regularly, and choose foods with ... losing weight; you need to exercise more and eat less. ...
Breaking Medicine News(10 mins):Health News:Researchers Say Antibiotics in Fish a Health Concern 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 2Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 3Health News:University of Pittsburgh Medical Center Launches Initiative to Emphasize Concussions Are Treatable 4Health News:Dr. Iris Hunter to Host Grand Opening of FirstLight HomeCare Tomorrow 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 2Health News:Hay House Announces The Official Release of Recovery 2.0: Move Beyond Addiction and Upgrade Your Life 3Health News:ReductionGuruMD Presents Ways to Improve Your Weight Loss Results 2
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions