Tag: "transplanted" at biology news

Algal contact as a trigger for coral disease

...ge number of coral colonies on which this alga was transplanted developed white plague whereas unexposed colonies did not. In addition, the plant was found to be a reservoir for the marine bacterium Aurantimonas coralicida, causative agent of the disease. The spread of macroalgae on coral reefs may account for th...

JCI table of contents September 15, 2004

...d colleagues, from the Scripps Research Institute, transplanted mouse or human adult bone-marrowderived stem cells...mouse models of retinal degeneration, whenever the transplanted stem cells stabilized and rescued the retinal blood vessels that would ordinarily completely degener...

Mitochondrial genes cause nuclear mischief

...ey are under the strict control of their host. The transplanted mitochondrial genes have been faithfully doing their job under new management since they were first appropriated, probably hundreds of millions of years ago. But in this issue, Miria Ricchetti and colleagues show that the over 200 mitochondrial genet...

Bone marrow cells routinely help with wound healing

...glow green. Afterward, only the bone marrow of the transplanted mice glowed green inside the bodies of the mice, a...ain protein, CD45. The new cells identified in the transplanted mice did not produce that protein, and do not seem to be implicated in contact dermatitis.Researcher...

Optimizing protein's 'death domain' halts leukemia in laboratory study

...cells. The most dramatic success occurred in mice transplanted with leukemia cells that gave off a glow when the mice were injected with a light-emitting substance, luciferin. After they administered the reinforced BH3 alpha helices, scientists noted that the glowing regions representing the leukemia cells retre...

Embryonic stem cell therapy shows steady benefits in rebuilding infarcted heart

...cell types into fully functional cardiac cells and transplanted them into damaged regions of the myocardium, where the cells integrated into the infarct and showed rapid and robust improvements, which were stable over an extended period post-therapy. The study, entitled "Stable benefit of embryonic stem cell the...

New mechanism for display of foreign proteins to immune system

...ntation and contributes to immunity to viruses and transplanted tissues. "We show unequivocally that this pathway is truly separate from the conventional TAP-dependent pathway. Having two distinct pathways involved in generating peptides, potentially in different amounts, could serve to increase the total number ...

Stem cell research targets cerebral palsy

...ral chemicals that assist healing may one day help transplanted adult stem cells integrate into an injured brain, ...ts with cerebral palsy, wants to determine whether transplanted stem cells work best when the cells are injected directly into the brain along with these natural ch...

Possible new cure for psoriasis

...od on animals, using naked mice on which they have transplanted the skin tissue of psoriasis patients. They want to apply the active ingredients locally as an ointment. In addition, the first tests on human beings are planned for the immediate future....

New discovery may help transplants survive

...use the eye is intrinsically less likely to reject transplanted material than other parts of the body. However, to suppress rejection of corneal transplants, patients need to use steroid drops which can cause glaucoma, cataract development, and infection -- for years. Even then, many corneal transplants fail, an...

Babies with DiGeorge syndrome saved by immune supression, thymus transplant

...o ensure that no diseases are transferred with the transplanted thymus tissue. Pediatric surgeons working with Markert transplant thin strips of donor thymus tissue into a recipient infant's thigh muscle, where it is most likely to develop a network of blood vessels to deliver nourishment and oxygen. After transp...

JCI table of contents, 2 August, 2004

...mune and inflammatory cells. When the researchers transplanted bone-marrow cells from p27kip1 defective mice into...rs looked at the vascular repair in mice that were transplanted with bone marrow from mice that are unable to make immune cells, these are called RAG deficient mice...

Save the rainforest - eat a tree

...white sand soils. In the new study, the scientists transplanted red clay tree species onto white sand soil, and transplanted white sand tree species onto red clay soil. Net-covered enclosures were built around half the transp...

Misfiring proteins tied to inflammation and sick feeling of type 2 diabetics

...cin, a drug used to lower the risk of rejection of transplanted kidneys, might reduce diabetes-associated inflammation and stabilize brain-immune system interactions....

K-State professor combines love of teaching, research to examine eye development

... scratched. "Corneas also are the most frequently transplanted tissue in the U.S., generally providing a clear, t...orneas become innervated may reveal clues by which transplanted adult human corneas can be coaxed to become innervated again....

Study yields insights into precancerous condition

...the drug rapamycin [commonly used to prevent newly transplanted organs from being rejected] could block mTOR," says Cantley. "These new results suggest that the use of mTOR inhibitors, including rapamycin analogs currently being tested in clinical trials for the treatment of cancers and tuberous sclerosis, may be...

Protective mechanism exploited by tumors may provide new cancer treatment

...xplored in other areas as well, such as protecting transplanted organs from rejection and helping the immune system fight HIV infection. Fortunately, several compounds that might inhibit IDO already existed, developed as part of studying pathways involving the natural amino acid, tryptophan. Tryptophan is a precu...

Mouse brain stem cells capable of converting into blood vessel cells

...s were seen when these same neural stem cells were transplanted into the brains of mice early in development....

Human periodontal ligament stem cells isolated for the first time

...tually form periodontal ligament and cementum when transplanted into mice? Of the 13 transplants - each of which was derived from a distinct colony of stem cells cultured in the laboratory and loaded into a hydroxyapetite carrier - eight produced a dense mixture of cementum and periodontal ligament. Interesting...

Macrophages, not stem cells, correct liver disease by fusion

... by cell fusion rather than differentiation of the transplanted stem cells. "Various labs have reported that bone ...crophages derived from bone marrow stem cells were transplanted into the spleens of mice with the genetic liver disease fumarylacetoacetate hydrolase deficiency, al...

1 2 3 4 5 6 7 8 9 10

(Date:5/23/2013)... (PRWEB) May 23, 2013 911 Signal USA ... expo will begin on May 22 and run through May ... and information about the company's emergency vehicle lights ... new 2013 Dodge Charger at the expo. , The Charger ... on the market and can be seen by visiting 911 ...
(Date:5/22/2013)... 2013 Most women dread cellulite and ... factors, including estrogen being a factor in the formation ... deposits stored and smashed together which create that dimpling ... take a multi-pronged action," says Kathy Heshelow, founder of ... products like Cellulite Whisperer ® that work to ...
(Date:5/22/2013)... Catalyst Exhibits, Inc., an award-winning global ... its website that allows visitors to view a ... immersive, 360-degree, interactive experience. , The new viewing ... virtually experience the exhibit design Catalyst created for St. ... Users have the ability to interact with the hi-resolution ...
(Date:5/22/2013)... San Francisco, CA (PRWEB) May 22, 2013 ... funerals costing $6,500 or more on average, a funeral concierge ... a funeral, among other benefits. Funeral Financials ... With the average household income in the U.S. ... recession according to Sentier Research, the average funeral costs 12.6% ...
(Date:5/22/2013)... MD (PRWEB) May 22, 2013 On a ... Lisa, spent a few hours watching “The Bourne Legacy” at ... While this may seem like a typical activity to many ... This little stretch of respite from their everyday reality has ... Seals Serving DC | MD | VA. , Life changed ...
Breaking Medicine News(10 mins):Health News:911 Signal USA Attends the 2013 Southwest Police Fleet Expo 2Health News:Get Cellulite Under Control Now with Cellulite Whisperer® Products Introduced by Sublime Beauty® 2Health News:Catalyst Exhibits Debuts 360 Degree Virtual Tour of St. Jude Medical Trade Show Booth 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 3Health News:Military Family Finds Respite with Easter Seals 2Health News:Military Family Finds Respite with Easter Seals 3
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore