The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "treatment" at biology news

Prostate Cancer's Aggressiveness May Be Predicted Early By The Ratio Of Free To Total PSA

...tate cancer, but there is great debate about which treatment is best for a cancer diagnosed in the early stage-watchful waiting, surgery to remove a localized cancer, or radiation therapy. Each has advantages and disadvantages. Radiation and surgery may be associated, in some cases, with complications includin...

Herpes-Based Gene Therapy Is Key To Promising Liver Tumor Vaccine

...nterleukin-2 (IL2) along with the gamma-interferon treatment was a very effective combination, completely preventing tumors from forming in 8 of 11 rats. IL-2 stimulates the formation of lymphocytes known as cytotoxic T cells, which are especially effective at killing cancer cells. The team also achieved notew...

Virus May Be Linked To Obesity -- Early Findings Hint At Relationship

... associated with asignificantly better response to treatment with obesity drugs, saidDhurandhar. "There has been an alarming worldwide increase in the prevalence ofobesity in the past 30 years," said Atkinson, noting that its prevalence inthe United States rose 30 percent between 1980 and 1990, affect...

University Of Washington Discovery May Point The Way To New Treatment For Hepatitis C Cases That Do Not Respond To Interferon Therapy

...an explanation for why the currently approved drug treatment for hepatitis C is ineffective much of the time. The drug, recombinant alpha interferon, is ineffective in 60 to 80 percent of cases. "This discovery explains the molecular mechanisms for interferon resistance, and points the way to a potenti...

Project Shows Native Bacteria Can Destroy Widespread Pollutant In Groundwater

... aquifers at different depths. The design uses two treatment wells. One well was designed to create a bacterial...it was sucked into the circular flow set up by the treatment wells, which pulled it through the two bacterial zones. Each pass through one of these bacterial zon...

Duke Study Shows Early Marrow Transplant Key To 'Bubble Boy' Disease Cure

...000," Buckleysaid. "If found later, less effective treatment can run into the millions." Babies born with...patientsbecause they are following standard cancer treatment protocol, Buckley said.But chemotherapy is not necessary in children with SCID because they haveno T...

Duke researchers find existing drugs can stop fungus that attacks AIDS patients

...athogens." Once an infection is established, treatment options are limited. Themost effective anti-fungal drug, called fluconazole, requires lifetime therapyin AIDS patients and has side effects such as nausea and kidney disease. The researchers found the immunosuppressive drugs cyclosporin and FK5...

Enzymes Targeted As Key To Understanding Drug Interactions

...tors and pharmacists will be able to select a drug treatment based on criteria that include the potential for interaction," said Levy. "We have begun developing computerized databases for use by pharmaceutical companies, pharmacists and physicians." The UW Program in Drug Interactions has taken its efforts be...

Bacterium gobbles up chlorinated pollutants

...fect dechlorinator, a quest that began in a sewage treatment plant. Zinder, a professor of microbiology, as well as graduate student Xavier Maymo-Gatell and other colleagues, used funding from the Cornell Center for Advanced Technology in Biotechnology and the U.S. Air Force to isolate Strain 195 from an ...

Merging Physics And Neuroscience: First Evidence Of Self-Organized Criticality In Brain Networks

...gnosing diseases ofthe brain, and perhaps even new treatment options. Modellingtechniques developed for the work could also give neuroscientistsa new way to study long-range signalling in the brain. "This work makes a connection between physics -- where weunderstand self-organized criticality -- and complex ...

Scientists Bridge Gap In Cell Communication

... the find promises a rational basis for the future treatment of some diseases and, more immediately, gives science a new grasp of a process that triggers decisive events in cells. Studying a well-known signaling protein called MAD, UW-Madison geneticist Allen Laughon and colleagues determined that the...

Jefferson Scientists Discover Mechanism Of Viral Link To Disease Commonly Associated With Asbestos

... function of the pRb2/p130 gene. To date, the treatment has shown success in animal studies and is about to enter phase 1 clinical trials in humans. Dr. Giordano was the first to identify and clone the pRb-2/p130 gene and demonstrate that it could halt the growth of tumors. He has ...

Fighting Wheat Scab In New York State

...ination of seeds in soil to the same extent as did treatment with chemical fungicides. Initial tests in Brazil indicate that the biocontrol strains are also effective in controlling disease under field conditions. The research team will test biocontrol strains in field plots in New York in 1998. "Biological ...

CSIRO Discovery Fights Cell Ageing

...dly recover their youthful appearance-- but if the treatment ceases they immediately become senescent. The CSIRO team also found that Beta Alistine' helps to prevent cross-linkingof collagen and other proteins in skin. Over the years, and especially withexposure to the sun, cross-links form between adjacent c...

Resistance To Leptin Contributes To Obesity

... reaching their lowest weight by the eighth day of treatment andmaintained it for the remainder of the 30-day infusion period. The micereduced their food intake to its lowest level, a drop of more than 50percent, by the third day, but their food intake crept back to originallevels by the eighth day. After th...

Huntington's Disease Findings Pave Way For Potential Cure

... been explained--and the newfindings may lead to a treatment or cure for the progressive, degenerative braindis...ditary Disease Foundation also seeks to advancethe treatment of these incurable and devastating illnesses. The foundation's Cure Huntington's Disease Initiative ...

Scientists Unlock Mystery Behind Proteins That Keep Tuberculosis Bacteria Alive; Finding Leads To Research Into New Drug Treatments

...sm time tomutate into new, resistant forms. Making treatment even more difficult is thefact that many TB sufferers stop taking antibiotics before the bacteria iseliminated. "This is a breakthrough because it offers a novel drug target fortuberculosis," Belisle said. "Based on this finding, we can creat...

Research Team Discovers Key Gene For Telomerase Enzyme In Humans

...t variants of "inhibitorssuch as AZT developed for treatment of AIDs may be able to inhibittelomerase," Nakamura said. Many researchers believe telomerase's most promising applicationmay be in diagnosing cancer. By developing ways to detect telomeraseactivity in cells, it may be possible to diagnose c...

Vitamin C Deficit Linked To Skin Disease

... to the same geneticdefect as PCT. The most common treatment for both diseases is blood drawing,which decreases...sing dietary levels ofvitamin C may have a role in treatment of the human disease, Sinclair cautionsthat a potentially adverse effect must first be ruled out. "T...

Menstrual Phase Linked To Ineffective Mammograms

...grams will not be recognized and the diagnosis and treatment of breastcancer will be delayed." "If some breast cancers are not detected by mammography, obviously theoverall benefit of screening programs is likely to be reduced," explains Baines. "Our study shows there is an opportunity to improve...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)... American Board of Medical Spe... the certification of physician specialists in the...A, as the organization’s new chief operating... EVANSTON, Ill. (Business Wire EON) De...experience working in various industries including...
(Date:12/1/2008)...SBURG, Pa., Dec. 1 /PRNewswire-USNewswire/ -- As...Acting Secretary of Health Everette James today ur...s that causes AIDS. He also highlighted ongoing ef...how it is prevented. , , "Our message is cl...ethnicity or race, being tested for HIV is the onl...
(Date:12/1/2008)...mography and sonography findings help doctors iden... according to a study performed at the University ...mage findings from 57 male patients who were diagn...tudy. "The findings show that breast cancer in men...rregular shape and spiculated (spiky or pointy) ma...
(Date:12/1/2008)...onary CTA offers a low cost, non-invasive alternat...ients who are suspected of having coronary artery ...coronary artery plaques, according to a study perf... Philadelphia, PA. , The study included 31 patie...plaques that were discovered during coronary CTA. ...
Breaking Medicine News(10 mins):Health News: ABMS Appoints Margaret Jung As New COO 2Health News:PA Department of Health Recognizes 20th Anniversary of World AIDS Day; Urges HIV Testing 2
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs