Tag: "tumorigenesis" at biology news

Three genetic steps convert normal mammary cells into breast cancer cells

...ntification of the minimal genetic requirements of tumorigenesis will help to understand the mechanisms underlying the uncontrolled and destructive growth behavior of cancer. The genes chosen for use in this experiment SV40 large-T, telomerase hTERT and oncogenic H-rasV12 interfere with essential regulatory path...

Understanding tuberous sclerosis

...of biological events linking TSC gene mutation and tumorigenesis has remained unclear. As published in Genes & Development, Dr. Duojia Pan and Dr. Xinsheng Gao have determined that TSC1 and TSC2 proteins form complexes in cells, and negatively regulate the insulin pathway in Drosophila. In Drosophila the insulin ...

Lymphoma gene found

...al tumor suppressor genes, like Dmp1, that promote tumorigenesis lends insight into the genetic culprits that may be responsible for tumor development when the list of usual suspects fails....

Other highlights in the March 20 issue of JNCI

...nescence, and these mutations may favor melanocyte tumorigenesis by impairing senescence, cell differentiation, and...ations in the INK4A-ARF locus may favor melanocyte tumorigenesis by impairing cell senescence and differentiation. They report their results in the March 20 issue of...

Of mice and men

...nificant difference in the pathway of Ras-mediated tumorigenesis in mice and humans. The Ras gene plays an important role in human tumorigenesis. Ras is a proto-oncogene: It encodes a protein (Ras) which normally regulates cell growth, but certain oncogenic mutations in the Ras gene can result in the production of...

Unraveling the genetics behind melanoma and colon cancer

...atenin, the role of g-catenin in Wnt signaling and tumorigenesis is less well established. To uncover novel genes that are activated in response to b- and g-catenin expression, Dr. Ben-Ze'ev and colleagues preformed a DNA microarray analysis of human renal carcinoma cells expressing b-catenin and/or g-catenin. Of ...

Scientists discover role for c-myc gene in tumor angiogenesis

...er delineation of role of c-Myc in promoting human tumorigenesis is needed, but as it stands, this study presents strong evidence to suggest that the disruption of c-Myc may prove successful as an anti-angiogenic tool in cancer therapy....

Scientists discover role for Cdk4 in making cells cancer resistant

...activated, demonstrating that Cdk4 is required for tumorigenesis even when commonly mutated tumor suppressor genes are non-functional. This discovery that diminished Cdk4 expression steers cells into a protective state of senescence against oncogenes like Ras has significant therapeutic implications. In light of ...

JCI Table of Contents, March 14, 2003

...0% of the samples) appears to be an early event in tumorigenesis andcan be detected in sputum samples. Thus it might serve as a potentialdiagnostic marker. CONTACT: Yi-Ching Wang National Taiwan Normal University Department of Biology No. 88, Sec. 4 Tingchou Road Taipei 116, TAIWAN Phone 1-8862-2933-6876 Fax 1-...

JCI table of contents, 2 June, 2003

...ases furin, PC5, and PC7 activate VEGF-C to induce tumorigenesis AUTHOR CONTACT: Abdel-Majid Khatib Ottawa Health Research Institute, Ottawa, Ontario, Canada. Phone: (613) 798-5555 ext. 16086 Fax: (613) 761-4355 E-mail: mkhatib@ohri.ca View the PDF of this article at: https://www.the-jci.org/press/17220.pdf ...

Finished Y-chromosome sequence reveals a genomic 'crystal palace'

...adal sex determination, skeletal growth, germ-cell tumorigenesis and graft rejection, he said. "We know that there are many diseases for which men or women are at higher risk," said Page. "It has been conventionally assumed that these differences in disease susceptibility reflect the action of sex hormones, and no...

Scientists identify genetic link between cancer and aging

... recognized deep links between cell senescence and tumorigenesis for some time. It's gratifying to see another of these links identified that is conceptually interesting and may have practical importance."...

JCI Table of Contents, 15 August 2003

...PANING COMMENTARY:Decrypting the role of Cripto in tumorigenesis AUTHOR CONTACT: Michael M. Shen Center for Advanc...nd the pathogenesis of developmental disorders and tumorigenesis of the central nervous system due to dysregulated Shh signaling mediated by IFN-gamma. TITLE: Dysre...

JCI table of contents, December 15 2003

...wth and tumor suppression. TITLE: Promotion of tumorigenesis by heterozygous disruption of the beclin 1 autophagy gene AUTHOR CONTACT: Beth Levine Columbia University College of Physicians and Surgeons, New York, New York, USA. Phone: 212-305-7312 Fax: 212-305-7290 E-mail: levine@cancercenter.co...

Cross-species comparison reveals shared features between tumorigenesis and organogenesis

... as Lobstein and Cohnheim in the 19th century that tumorigenesis recapitulates aspects of development," Rowitch sai...rk within which gene expression in development and tumorigenesis can be studied. By this means, the role of a particular gene in tumor progression can be better unde...

Other highlights in the May 5 JNCI

...ansfected cells in vitro and in rodent models of tumorigenesis and angiogenesis. The DNAzyme-transfected endothelial cells expressed less c-Jun protein than mock-transfected cells. Transfection with the DNAzyme blocked endothelial cell proliferation and migration in vitro , inhibited angiogenesis in rat corneas...

1

(Date:5/23/2013)... (PRWEB) May 23, 2013 911 Signal USA ... expo will begin on May 22 and run through May ... and information about the company's emergency vehicle lights ... new 2013 Dodge Charger at the expo. , The Charger ... on the market and can be seen by visiting 911 ...
(Date:5/22/2013)... 2013 Most women dread cellulite and ... factors, including estrogen being a factor in the formation ... deposits stored and smashed together which create that dimpling ... take a multi-pronged action," says Kathy Heshelow, founder of ... products like Cellulite Whisperer ® that work to ...
(Date:5/22/2013)... Catalyst Exhibits, Inc., an award-winning global ... its website that allows visitors to view a ... immersive, 360-degree, interactive experience. , The new viewing ... virtually experience the exhibit design Catalyst created for St. ... Users have the ability to interact with the hi-resolution ...
(Date:5/22/2013)... San Francisco, CA (PRWEB) May 22, 2013 ... funerals costing $6,500 or more on average, a funeral concierge ... a funeral, among other benefits. Funeral Financials ... With the average household income in the U.S. ... recession according to Sentier Research, the average funeral costs 12.6% ...
(Date:5/22/2013)... MD (PRWEB) May 22, 2013 On a ... Lisa, spent a few hours watching “The Bourne Legacy” at ... While this may seem like a typical activity to many ... This little stretch of respite from their everyday reality has ... Seals Serving DC | MD | VA. , Life changed ...
Breaking Medicine News(10 mins):Health News:911 Signal USA Attends the 2013 Southwest Police Fleet Expo 2Health News:Get Cellulite Under Control Now with Cellulite Whisperer® Products Introduced by Sublime Beauty® 2Health News:Catalyst Exhibits Debuts 360 Degree Virtual Tour of St. Jude Medical Trade Show Booth 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 2Health News:Funeral Financials Announces Their Top 3 Reasons to Hire a Funeral Concierge 3Health News:Military Family Finds Respite with Easter Seals 2Health News:Military Family Finds Respite with Easter Seals 3
Other Tags
reversiblyswitchesmitslittlerappliesspecificityforeveraustraliansrelyfeversovertakemortemscarspresentingpodcastcore