Tag: "uncoupled" at biology news

Heart size and function uncoupled by researchers

...es in heart size and function and have genetically uncoupled them, a discovery the scientists hope will lead to better treatments for those with cardiovascular disease. "We initially had a hint that the protein called PTEN controls cell size," says Josef Penninger, professor of medical biophysics and immunolog...

Oxidative damage to eNOS by tissue peroxynitrite

...f recombinant eNOS, the combination of coupled and uncoupled catalysis generates NO and superoxide, and therefo... homodimer, leaving an enzyme that operates in the uncoupled mode. The structural change thus favors the production of more superoxide and peroxynitrite, which c...

MCG researchers study hormone that may prevent bone being lost in space

...n bone. The balance of bone loss and production is uncoupled by weightlessness and by hormonal loss that occurs with age, Dr. Isales said. "You can break down bone, but you don't form it as well," without the natural force of gravity. Bone loss and production are constants in life, with the average person refo...

Brain neurochemicals, not gender, tell a female to act like a female

...gonadal sex and social/reproductive tactics may be uncoupled from each other and regulated independently within the same brain region." Goodson adds, "Apparently, the process of evolution has modified reproductive and social behavior independent of the gonads. This blending of characteristics should make mo...

1

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument