The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "uncovers" at biology news

Genetic basis of hereditary nerve disorder revealed

...underlie various forms of CMT, the current finding uncovers a whole new mechanism of action that can cause disease by damaging mitochondria, said lead author of the study Stephan Zchner, M.D., of the Duke Center for Human Genetics and the department of neuropathology at the University Hospital Aachen in Germa...

Cellular fat sensor slows heart disease

...f Science and is posted on the journal's web site, uncovers a unique pathway that significantly curbs the development of atherosclerosis - the accumulation of fatty deposits on arterial walls. The pathway could be used to develop drugs to treat heart disease, currently the number one killer of Americans. Rona...

Victoria Hale of Institute for OneWorld Health Named Fellow by International Women's Forum

...hose experienced team of pharmaceutical scientists uncovers promising drug candidates and advances them through clinical trials and regulatory approval to treat the poorest people in the developing world. This honor is the third international award in three weeks that recognizes Hale's leadership and vision...

Schwab foundation names Victoria Hale a social entrepreneur for 2004

...th's experienced team of pharmaceutical scientists uncovers promising drug candidates and advances them through clinical trials and regulatory approval to treat the poorest people in the developing world. This entrepreneurial model was designed to create a win-win situation, both for those without access to ...

While the homeland is on alert, Technical Insights provides indispensable technology information

...rity Alert subscription service. This subscription uncovers and evaluates emerging technological developments as they relate to homeland security. In this subscription service, important new equipment, systems, applications, markets, companies, and technologies in the field are assessed. The Homeland Security...

Development of hair depends on development of the hair channel

...tissues," says Kaufman. Adds Fuchs, "Knowing this uncovers an intriguing parallel between the pathways taken by the stem cells of our immune system and those of our skin. This knowledge may help us to understand more about the fundamental properties of stem cells in the body." Yin and yang of hair follicle...

Controlling body size by regulating the number of cells

...Research published in Journal of Biology this week uncovers a key pathway that controls the number of cells in an animal, thereby controlling its size. Ernst Hafen and his colleagues from the University of Zrich used fruit flies to investigate the role of the insulin-signalling pathway and in particular a mol...

Molecule helps prevent inflammation and heart disease in fat-fed mice

...ndocrinology, Metabolism and Lipid Research. "This uncovers an interesting role for beta3 as a potential mediator of inflammation and may help guide new drug development strategies." Beta3 sits on the surface of cells and interacts with other molecules in the body to help regulate functions like blood clottin...

Whale study links genetics and reproductive success

...han other lines in the past decade, a finding that uncovers the often-complex role of genetics and environment in the makeup of this population of long-lived mammals. In the study, published in the most recent issue of The Journal of Heredity, researchers compared more than two decades of field observations ...

Rockefeller, Weill Cornell researchers find link between estrogen, brain structure changes

...y researchers have been trying to explain --and it uncovers a functional role for protein synthesis that occurs far away from the cell body near the synapses. Protein synthesis is thought to be important in learning and memory. "This marries two schools of neurobiology together," Akama says. "Much was known w...

Genes, neurons, and the Internet found to have some identical organizing principles

...study published in the October 25 issue of Science uncovers a strategy for finding the organizing principles of virtually any network from neural networks to ecological food webs or the Internet. A team headed by Dr. Uri Alon, of the Weizmann Institute of Science's Molecular Cell Biology Department has fou...

New enzyme pathway to nerve cell death discovered in stroke and neurodegenerative diseases

...rve cells, resulting in their death. "The new work uncovers the mechanism of activation of an enzymatic pathway that leads to nerve cell death," said Stuart A. Lipton, M.D., Ph.D., a neurologist who is Professor and Director of the Center for Neuroscience and Aging at The Burnham Institute, and head of the te...

Exploring the genetic commonality of alcohol and tobacco abuse

... of Alcoholism: Clinical & Experimental Research uncovers new evidence which supports the theory that common genetic factors influence sensitivity to both alcohol and nicotine, the alkaloid responsible for many of the effects of tobacco, including addiction. "Numerous studies in the last several decades hav...

April GEOLOGY and GSA TODAY media highlights

...distributed among the sampled species). This study uncovers a systematic difference in the abundance distribution of species between early Paleozoic (545-420 Ma) and Cenozoic (65-0 Ma) fossil samples. Early Paleozoic samples are dominated by few genera (used as a proxy for species here), whereas Cenozoic samp...

Researchers discover mechanism of plant resistance to pathogens

...) and published in the February 28 issue of Nature uncovers the molecular basis by which this resistance occurs. The work holds promise for designing hardier crops. Weve identified a key molecular pathway within plant cells, says scientist Jen Sheen of the molecular biology department at Massachusetts G...

Researchers discover mechanism of plant resistance to pathogens

...earch published in the February 28 issue of Nature uncovers the molecular basis by which this resistance occurs. The work holds promise for designing hardier crops. "We've identified a key molecular pathway within plant cells," says principal investigator Jen Sheen, Ph.D. of the Molecular Biology Departmen...

UC Berkeley expert on insect flight receives prestigious MacArthur 'genius' award

...isticated of all flying animals. The principles he uncovers are even now being applied to the development of tiny flying robots that have potential use in search and rescue, environmental monitoring and remote sensing. "Flies are the most accomplished fliers on the planet in terms of aerodynamics," Dickinson...

Researchers find glass-eating microbes at the rock bottom of the food chain

...ystems (http://g-cubed.org), a team of researchers uncovers and characterizes a process that is commonplace below the ocean bottom. In the upper 300 meters of the earths oceanic crust, microbes were found to have literally eaten their way through rock. Traces of this process are preserved in the glassy margin...

AFAR announces 189 new grants for aging research totalling $10 million

...er year. "This two-tiered review process not only uncovers promising new topics in aging research, it also provides support for new approaches to the care and treatment of diseases and conditions such as Parkinson's and incontinence," commented Dr. Vincent J. Cristofalo, Chair of AFAR's Research Committee....

Scientists shake up "family tree" of green plants

...of green plants, according to scientists. Also, it uncovers a research shortcoming: All main plant model organisms used for research (such as Arabidopsis, which became the first plant to have all its genes sequenced) are recently evolved flowering plants. This limitation could compromise scientific res...

1 2

(Date:12/1/2008)... American Board of Medical Spe... the certification of physician specialists in the...A, as the organization’s new chief operating... EVANSTON, Ill. (Business Wire EON) De...experience working in various industries including...
(Date:12/1/2008)...SBURG, Pa., Dec. 1 /PRNewswire-USNewswire/ -- As...Acting Secretary of Health Everette James today ur...s that causes AIDS. He also highlighted ongoing ef...how it is prevented. , , "Our message is cl...ethnicity or race, being tested for HIV is the onl...
(Date:12/1/2008)...mography and sonography findings help doctors iden... according to a study performed at the University ...mage findings from 57 male patients who were diagn...tudy. "The findings show that breast cancer in men...rregular shape and spiculated (spiky or pointy) ma...
(Date:12/1/2008)...onary CTA offers a low cost, non-invasive alternat...ients who are suspected of having coronary artery ...coronary artery plaques, according to a study perf... Philadelphia, PA. , The study included 31 patie...plaques that were discovered during coronary CTA. ...
Breaking Medicine News(10 mins):Health News: ABMS Appoints Margaret Jung As New COO 2Health News:PA Department of Health Recognizes 20th Anniversary of World AIDS Day; Urges HIV Testing 2
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs