The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "vaccines" at biology news

Millennium and Wyeth-Ayerst announce the discovery of key potassium ion channel modulating proteins

...al nervous system drugs, anti-inflammatory agents, vaccines and genetic pharmaceuticals. American Home Products Corporation is a world leader in the research, development and marketing of pharmaceuticals and other health-care products. It is also a leader in agricultural products, animal health care, medical ...

Delivering the fruits of biotechnology to the developing world: Institute for Global Health sponsors global health forum, February 18-21

... studyhow best to promote development of drugs and vaccines for the world's poorestcountries. This Global Health Forum: "Creating Global Markets for Orphan Drugs& Vaccines: A Challenge for Public/Private Partnership," will be sponsored bythe Institute for Global Health, of the University of California, SanFra...

Scientists discover key molecule in transmission of AIDS virus

...ng innovative treatments for AIDS, and may lead to vaccines that could prevent the virus from gaining access t...is information potentially could be used to design vaccines that will elicit antibody responses that block the interaction of HIV with dendritic cells and to de...

Chiron reports on discovery of novel men B vaccine candidates based on whole genome sequencing of Neisseria meningitidis by TIGR

...ventional research approaches to develop effective vaccines against different strains of group B meningococcus have failed," said Rino Rappuoli, Ph.D., co-author of the Science papers and Chiron's vice president of vaccine research. "A genomics-based approach is a completely novel paradigm and allowed the di...

New findings on genetically modified plants and foods

...fornia researchers will discuss administering oral vaccines through edible transgenic plants, including a potential vaccine for transmissible gastroenteritis and cryptosporidiosis (a parasitic infection caused by contaminated water or food) and treatment of autoimmune diseases. Texas chemists will report on t...

AVAX Technologies' AC Vaccine™ improves relapse-free survival

...ology to demonstrate the promise of our autologous vaccines as an effective treatment for a variety of late stage cancers." AVAX's AC Vaccines are made from the patient's own cancer cells by modifying the tumor cells with a molecule called a "hapten." This process, known as "haptenization," alters the tu...

Scientists, research advocates honored as Albert B. Sabin Heroes of Science

...ent of nearlythree dozen live, killed and combined vaccines including measles,mumps, rubella, MMR, Marek's Dis... B, aswell overseeing the commercial evolution of vaccines againstmeningococci and pneumococci . His measles vaccine alone isestimated to prevent one million ...

Scientists on scent of better coyote management

...attractants for the targeted delivery of drugs and vaccines and for the effective operation of traps," says Br...ope that this method can be used to deliver rabies vaccines to coyotes, which are a primary carrier of the disease. They can transmit it to dogs, which can pass...

Discussion May 24 on recommendations for animal studies on DNA-based therapies, herbs, emissions from cellular phones

...ominated for safety testing a class of DNA-derived vaccines and gene therapies not yet generally available, as...as a secondary issue. However, more recently, DNA vaccines and synthetic oligos have been developed for use in relatively healthy children and adults, making l...

Susan Okie receives microbiology communcations award

...ed the importance of researching new medicines and vaccines for tuberculosis if it is to be eradicated. "Okie realized that the battle against tuberculosis provided the perfect opportunity to show how far medicine has come in combating pathogenic agents as well as the limits of modern science in fighting age-...

Just-published research shows for the first time that Lyme Disease bacterium does not require iron to infect host

...new discovery can be used in developing either new vaccines or new therapies for those infected with Lyme disease is not yet clear. While a vestigal iron pathway may still exist in Borrelia burgdorferi, simply adding iron to a diet or as a medical therapy would do little good. Still, because other metals su...

Fruit fly model could explain how mosquitoes carry malaria: new drugs and vaccines on the horizon

...t lead to a transmission-blocking vaccine. Malaria vaccines have been particularly elusive because Plasmodium hide inside human cells, making it difficult for the immune system to locate and purge it from the body. Furthermore, the parasite acts like a chameleon, constantly changing its surface so the immune ...

NIH scientists unravel clues to ebola hemorrhaging

...l walls. By attacking this protein, new drugs and vaccines may be designed to reduce or prevent the disease. Ebola virus is the most infamous of the hemorrhagic fever viruses, a group of microbes found only in humans and monkeys. Although these outbreaks are not common or widespread, they have received ...

Vaccine put into tomatoes shows promise fighting virus in lab tests

...immune systems." Instead of injecting serum-based vaccines that stimulate an immune response in the bloodstream, edible vaccines could be used medicinally to build protection in the mucosal system -- immune cells along the nose, ...

DNA-based flu vaccine raises protective immunity

... that could serve as a template for more effective vaccines against a variety of viral illnesses, including HI...a virus. For purposes of comparison, two other DNA vaccines were also constructed based on a secreted form of HA (sHA) and a transmembrane (tmHA) version. Mice ...

Fred Hutchinson Cancer Research Center to lead international team to accelerate investigation of immune-related genes

...ple more susceptible to specific diseases? Why do vaccines protect some individuals better than others? In se...eoretically, someday scientists could custom-build vaccines based on HLA genes. Such vaccines could provide better protection against diseases endemic to a gro...

No AIDS-related viruses or chimpanzee DNA found in 1950's-era polio vaccine

...nfidence in the production and administration of vaccines and in the response of science to public inquiry." For the tests, the Wistar samples were subdivided and coded by Dr. Vincent Racaniello, Columbia University College of Physicians and Surgeons, New York, NY. Sets of the samples were ...

Scientists reveal new HIV vaccine target

... of the virus for inclusion in an HIV vaccine. "If vaccines can induce these killer T cell responses before infection occurs, the opportunity for the virus to subsequently escape from these immune responses would be greatly reduced." Scientists have previously shown that treatment of HIV-infected patients wit...

NIGMS Structural Genomics Awards scale up protein structure studies

...l lead to the design of new and improved drugs and vaccines for tuberculosis. (Thomas Terwilliger, Los Alamos National Laboratory) The Southeast Collaboratory for Structural Genomics, with its core in Georgia and Alabama, will analyze part of the human genome and the entire genomes of two representative org...

Tiny microchips have big promise in fighting serious diseases

...uld never feel the pain. While the field of cancer vaccines is in its "infancy," said Caligiuri, there is the potential to develop a vaccine-containing chip or slow-release capsule taken orally that can target specific types of cancer. "Cancer prevention via vaccination is a huge frontier," he said. Other tha...

1 2 3 4 5 6 7 8 9 10

(Date:12/1/2008)... American Board of Medical Spe... the certification of physician specialists in the...A, as the organization’s new chief operating... EVANSTON, Ill. (Business Wire EON) De...experience working in various industries including...
(Date:12/1/2008)...SBURG, Pa., Dec. 1 /PRNewswire-USNewswire/ -- As...Acting Secretary of Health Everette James today ur...s that causes AIDS. He also highlighted ongoing ef...how it is prevented. , , "Our message is cl...ethnicity or race, being tested for HIV is the onl...
(Date:12/1/2008)...mography and sonography findings help doctors iden... according to a study performed at the University ...mage findings from 57 male patients who were diagn...tudy. "The findings show that breast cancer in men...rregular shape and spiculated (spiky or pointy) ma...
(Date:12/1/2008)...onary CTA offers a low cost, non-invasive alternat...ients who are suspected of having coronary artery ...coronary artery plaques, according to a study perf... Philadelphia, PA. , The study included 31 patie...plaques that were discovered during coronary CTA. ...
Breaking Medicine News(10 mins):Health News: ABMS Appoints Margaret Jung As New COO 2Health News:PA Department of Health Recognizes 20th Anniversary of World AIDS Day; Urges HIV Testing 2
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs