Tag: "vehicles" at biology news

Cancer vaccine based on pathogenic listeria bacteria shows promise targeting metastases

...mors. The listeria bacteria are uniquely effective vehicles for a cancer vaccine, Portnoy said, because the bacteria incite a strong "innate" response from the immune system and at the same time sneak cancer antigens into cells to optimally stimulate a potent "acquired" immune response. Together, these two in...

The search for a kinder, gentler chemotherapy

... "The possibility for using these nanoparticles as vehicles to target and kill only cancer cells is particularly exciting," said Jean Chmielewski, professor of chemistry at Purdue University. "Decorating the exterior of the vehicle with folic acid is a very direct route to enter cancer cells. This type of an ...

Chernobyl study: Risk of thyroid cancer rises with radiation dose

...m scratch." Challenges included purchasing Russian vehicles for the field teams using federal dollars an unprecedented bureaucratic challenge for the researchers importing all laboratory equipment and supplies, and then figuring out a way to maintain them without the standard resources that one takes for gr...

No longer just for biology, RNA can now be built into 3-D arrays

...hich diagnostic chips, tiny sensors, gene delivery vehicles and other nanoscale devices will be mounted or constructed. From the researchers: "Living systems contain a wide variety of nanomachines and ordered structures, including motors, pumps and valves. Our research is devoted to making these machines f...

X marks the spot: Vector insertion is viral specific

...hia, PA) - Retroviruses are one of the most common vehicles for delivering therapeutic payloads via gene therapy in animal models of disease and human patients. Viruses integrate into host DNA to replicate, but exactly where they insert themselves has become a topic of increasing importance. This is of specia...

Revealing bizarre deep-sea secrets

...al techniques. Submersibles and remotely operated vehicles can scare away most mobile life with their bright lights, loud noises, and strong electrical fields, while nets allow countless animals to swim away unseen and shred slower, softer animals beyond recognition. "We're absolutely certain that we're st...

A changing landscape may have dire implications for birds

...activities, such as the growing use of all-terrain vehicles and the replacement of native vegetation with exotic and ornamental plants, reduces cover and food resources for native birds. Native species like house wrens, robins and catbirds can benefit from human changes to the landscape, but species like the ...

Two billion vulnerable to floods by 2050; number expected to double or more in two generations

...ally cause thousands of deaths through drowning in vehicles and homes, accidents while walking or driving around water, electrocution, roof collapses, lightning strikes and heart attacks, as well as through the elevation of water-related disease. Making vulnerability of people the centre of policy focus...

After natural disasters, the risk of infection, epidemics from dead bodies is negligible

...handling cadavers, and disinfecting stretchers and vehicles that have been used to transport bodies. Unjustified worries about the infectiousness of bodies can lead to the rapid, unplanned disposal of the dead, sometimes before proper identification of the victim has been made, as well as to taking needless ...

Study of Cape Cod Seashore finds off-road vehicles harmful to beach fauna

KINGSTON, R.I. -- May 20, 2004 -- When off-road vehicles drive on beaches, they can reduce the number of cr...d feed under the wrack," Steinback said. But when vehicles drive over the wrack, their tires break up the vegetation, which makes it dry out. "That changes th...

Study suggests insect-derived antimicrobial peptides could be used as drug-delivery vehicles

...ether these peptides could be employed as delivery vehicles for other peptide or peptide-based drugs that would not normally be able to penetrate mammalian cell membranes and tissues. In their study, published online today in Molecular Pharmaceutics, the researchers showed that native pyrrhocoricin can penetr...

'Springer' - A solution to water pollution?

...ies, and to industry. The information generated by vehicles like Springer could make a major contribution to the effective cleaning up of our waterways"....

New RNA libraries can selectively inactivate human genes

...ective structures and even more effective delivery vehicles which will be built into future generations of this library." Once an optimized basic design of the short hairpin RNA molecule was finished, the researchers then produced a library of genes for short hairpin RNAs that could target 9,610 human...

Ribozyme package effective against hepatitis B virus

...SNIPAA cassette was packaged in liposomes, typical vehicles for delivering drugs in the body, and the liposomes in turn were modified with proteins so that they would seek out the liver cells where the HBVs replicate. Once at the liver cell, the SNIPAA cassette package is released into the cell and finds its ...

McGill scientists publish detailed picture of how nutrients and other molecules get into cells

... clathrin-coated vesicles. These vesicles are the vehicles by which cells are able to take up nutrients, such as cholesterol, from their environment. Defects in this uptake process have profound repercussions on cellular function and human health. For example, genetic diseases that lead to deficiencies in ...

UNC study may improve gene therapy safety

...Viruses genetically engineered for use as delivery vehicles for transferring therapeutic genes into the body may alone influence gene expression, or which genes are turned on.Moreover, depending on the type of virus, they may do so in potentially harmful ways. "This basically tells us that the messenger play...

Steroid-coated DNA represents new approach to gene delivery

...ering cells. Viral carriers can serve as delivery vehicles for DNA, literally infecting cells with new genes. Both methods, however, are associated with the creation of inflammatory immune responses that reduces the action of the therapeutic gene. DNA is a large and negatively charged molecule, which is the...

Pesticide exposure among agricultural workers varies by job task

...xposure patterns. Dust samples from households and vehicles of 213 randomly selected study participants were checked for the presence of six organophosphorous pesticides. Urine samples from these workers and family members (one adult and one child per household) were analyzed for the presence of five pesticid...

Successful progress launch paves the way for further scientific utilisation of the ISS by Europe

...ss-type spacecraft are currently serving as supply vehicles for the International Space Station and are also u...heat distribution systems for satellites and space vehicles in future. PROMISS-3 : The experiment aims to analyse the growth of protein crystals in weightless...

Mars mission scientist will live a 25-hour day

...ite of instruments carried by the two rovers. "Our vehicles are tied to the Martian day/night cycle," says Squyres, who is professor of astronomy at Cornell. "They rely on a vision system to avoid obstacles," and being solar powered they must operate during daylight and "sleep" at night. Because the rovers' ...

1 2 3 4 5 6

(Date:7/24/2014)... IL (PRWEB) July 24, 2014 In a ... infertility expert and founder of Lotus Blossom Consulting LLC ... Rosato entitled Three Ways to Cut the High Cost ... way to minimize costs is to maximize your chance of ... advice on choosing a clinic. , “I am always ...
(Date:7/24/2014)... the risk for head and neck cancer (HNC). Evidence suggests ... the risk of HNC in patients with DM has not ... sixth most common type of cancer. It accounts for about ... new cancer cases and 350,000 cancer deaths worldwide each year. ... to examine the risk of HNC in patients with DM. ...
(Date:7/24/2014)... Kan. (PRWEB) July 24, 2014 ... announces that it has achieved certification for compliance ... tested and verified by the DoD Information Assurance ... Vendor Neutral Archive, identified within the DoD as ... Authority to Operate designation from the U.S. Army ...
(Date:7/24/2014)... Hospital and the University of Tennessee Health Science Center ... drug shown to safely reduce the viral load and ... respiratory syncytial virus (RSV). RSV is the most common ... in the United States and worldwide. , The ... John DeVincenzo, MD. DeVincenzo,s Le Bonheur lab has been ...
(Date:7/24/2014)... Moines, IA (PRWEB) July 24, 2014 Members ... keep Michael Wolnerman, RPh, CCIM, Senior Associate of Sales at ... the Governor appointed him to the Board and that his ... , “I want to provide the best I can for ... believe I am uniquely positioned to provide a special insight ...
Breaking Medicine News(10 mins):Health News:Mindy Berkson, Infertility Expert and Founder, Lotus Blossom Consulting LLC: Leading the Pathway to Parenthood 2Health News:Mindy Berkson, Infertility Expert and Founder, Lotus Blossom Consulting LLC: Leading the Pathway to Parenthood 3Health News:Perceptive Software Achieves DIACAP Certification for Vendor Neutral Archive Solution to Support U.S. Department of Defense Integrated Clinical Systems Program 2Health News:Perceptive Software Achieves DIACAP Certification for Vendor Neutral Archive Solution to Support U.S. Department of Defense Integrated Clinical Systems Program 3Health News:Perceptive Software Achieves DIACAP Certification for Vendor Neutral Archive Solution to Support U.S. Department of Defense Integrated Clinical Systems Program 4Health News:RSV research breakthrough to help infected children 2Health News:Wolnerman Re-elected as Chairperson of Iowa State Board of Health 2
Other Tags
gravitationalelongatefeetclamriboswitchespeeksgenesystemsstrepcommunicationstronglyyouthsvaccinatingsurgeplanningmyeloidpotency