Tag: "versus" at biology news

Gretchen Daily named Nature Conservancy senior scholar

...her scientist to make clear it is not conservation versus people, but conservation and people." As a Smith Scholar, Daily will be evaluating an array of promising new financial incentives designed to encourage judicious custodianship of natural resources before they come under threat. These incentives inc...

Are we mice or men? Gene mutation linked to improving heart failure in mice proves lethal in humans

...Y: The challenge of molecular medicine: Complexity versus Occam's Razor CONTACT: W. Jonathon Lederer Dept. Of Physiology Univ. Of Maryland School Of Medicine 660 W. Redwood St. Baltimore, MD 21201 USA Phone 1-410-706-3852 Fax 1-410-706-8341 E-mail: jlederer@umaryland.edu...

Tea complements drugs in fight against colon cancer

...s of efforts to examine the effectiveness of white versus green tea in blocking mutagens and preventing cancer. In the latest study, they examined green and white teas that have high levels of the protective polyphenols called catechins, and also compared these teas to sulindac. This drug is commonly used a...

Gene variant discovery could save blood in surgery

...of a blood transfusion if you have factor V Leiden versus if you dont, he said. The current findings demonstrate that factor V Leiden offers a protective effect with respect to blood loss and transfusion after cardiac surgery. But the gene variant may also play a sinister role. The question now is does fac...

Backstage with a command performer

...fference between 50 million antibody possibilities versus 50,000 in mice without Ezh2." A biochemical theory bears physiological fruit Scientists were somewhat puzzled when the total number of genes in the human genome amounted to about 30,000, less than half the predicted amount. Turns out, DNA -- that ...

New studies reveal connections between oceanographic processes and rockfish populations

...t recruit during relaxation events (several months versus several weeks). The species that recruit during upwelling events include black rockfish, blue rockfish, olive rockfish, and yellowtail rockfish. The species that recruit during relaxation events include gopher rockfish, kelp rockfish, and black and y...

Phase III, 48-Wk NEAT study results comparing GW433908 to Nelfinavir presented today

...(908) in antiretroviral therapy-nave HIV+ patients versus nelfinavir (NFV/Viracept), were presented here tod...mL and 55 percent achieved vRNA <50 copies/mL, versus 35 percent and 24 percent, respectively, among patients taking nelfinavir, according to Dr. Nadler. ...

24-Wk data from CONTEXT trial comparing GW433908/ritonavir QD & BID to Lopinavir/ritonavir BID

...d in 8 percent of patients taking 908/r BID (n=8,) versus 4 percent of patients taking 908/r QD (n=4) or LPV/r BID (n=4). Mean fasting cholesterol levels for all three study groups remained below the recommended National Cholesterol Education Program (NCEP) intervention guidelines. Study Demographics The s...

Braille found to be essential, regardless of age of blindness

...tex between persons who become blind early in life versus those who acquire blindness later (e.g., before ag...s. after age 12). The differing results with early versus late onset blindness raise questions regarding the period of susceptibility for cross-modal reorgani...

Pacemaker therapy halves heart failure deaths

...maker therapy (called "cardiac resynchronization") versus no therapy in patients with dysfunction of the left ventricle, the heart's main pumping chamber. Four studies of 1,634 patients were selected for analysis. The majority of patients were men ages 63 to 66 with moderate to severe heart failure. In th...

Gene loss creates age- and gender-dependent cancer syndrome in mice

...es the rate of tumors as normal mice (34.2 percent versus 14.3 percent of normal mice). Oddly, the researchers say, the kind of cancer that popped up depended on the mouse's sex. Female mice tended to develop lymphomas and sarcomas, while male mice developed more epithelial cancers. Chen also found that e...

Newly developed tool aids study of Fragile X syndrome

...xpression in neurons of animals than can make FMRP versus animals that cannot," said Greenough, who holds a Swanlund Endowed Chair at Illinois. "In essence, we've shown that a major symptom of Fragile X syndrome is accounted for, in principle, by the binding of FMRP to the gene product, the messenger RNA t...

Using sewage sludge as fertilizer

...ed the effects of different kinds of sewage sludge versus commonly used synthetic nitrogen fertilizer on the forage crop bahiagrass. Researchers Martin B. Adjei and Jack E. Rechcigl studied yield, protein content, mineral content, and digestibility. Accumulation of heavy metals and nutrients in the crops, ...

Coral smothering 'green tide' seaweed spreading on Florida reefs

... nitrogen in the form found in sewage is available versus how it responds to nitrogen as it occurs naturally in seawater. They will also analyze the chemical signature of macroalgae samples for evidence of which type of nitrogen is driving growth. In addition, the team will measure the way the macroalgae ...

Monkeys show sophisticated learning abilities

...istinguishable on pairs that were within one list, versus pairs that were between lists. "I was very surprised that there was no significant difference in accuracy between these two types of comparisons -- that the animals really treated them as the same problem," said Brannon. "They showed logical acquisi...

For spinal cord injury patients, new insights for rehabilitation therapy

...tween the effect of loss of central neural control versus deconditioning, a group of nine SCI patients was trained for six weeks and showed a 30 percent increase in leg blood flow with unchanged blood pressure levels, indicating a marked reduction in vascular resistance. Conclusions The researchers concl...

Researchers find a genetic connection in Sudden Infant Death Syndrome (SIDS)

... increased frequency of the L allele in SIDS cases versus ethnicity/gender matched controls with no family h...hermore, there were significantly fewer SIDS cases versus controls with no long allele (S/S genotype) in the entire cohort and within the Caucasian subgroup; ...

Research shows less income, education not always top factors in child obesity

...h higher overweight among Hispanic and black males versus white and Asian males, even at the more elevated income and education levels." The conclusion they drew was that since obesity differences are not just reflections of socioeconomic differences -- as often believed -- broad public health efforts may i...

New role for tamoxifen as fertility drug for breast cancer patients?

...eater number of mature eggs than the controls (1.6 versus 0.7) and embryos (1.6 versus 0.6). All tamoxifen patients generated embryos compared with three out of five controls. After a mea...

First study to show the potential for effective prevention of migraine with an AT1 receptor blocker

... headaches in the 12 week placebo period was 18.5, versus 13.6 in the 12 week candesartan period (p=0.001). These data also show significance (p<0.001) for key secondary endpoints including: hours with headache; days with migraine; hours with migraine; headache severity; and level of disability. Days w...

1 2 3 4 5 6 7 8 9 10

(Date:8/23/2014)... The MPWMD Board of Directors voted on Monday, August 18th ... of water for commercial and industrial properties. This was ... Archworks, LLC in Carmel, California. , This is a ... district in the State of California has approved this technology ... this time can now be used as a sole source ...
(Date:8/23/2014)... Professional kitchen employees, prospective chefs and food ... for Food Safety Certification exams thanks to the free ... , Dynamic Path announced the release of its Food ... review questions for culinary industry students and professionals. ... of the ServSafe® Food Safety Certification, National Registry of ...
(Date:8/23/2014)... 2014 Pixel Film Studios, a leader of ... release of ProIntro Vol.3, a customizable title tool for ... tile just by dragging ProIntro Vol.3 in their timeline" says ... a definite time saver and i think our users will ... beautifully designed titles made with Final Cut Pro X users ...
(Date:8/23/2014)... Young adults in Athens, GA who find that they ... the phone and call the new helpline which can offer support ... , Troubled Teen Athens is a wonderful resource for an adolescent ... necessary steps to end substance abuse once and for all. When ... friends or peers when really they should put their faith in ...
(Date:8/23/2014)... Dealing with a drug or alcohol substance abuse ... is a child. Adolescent addiction has been an important issue ... a new helpline is now providing a valuable resource for ... a real addiction recovery center. , The Troubled Teens Atlanta ... the community. By calling (404) 975-2762, parents and their teens ...
Breaking Medicine News(10 mins):Health News:Historical Moment in the Monterey Peninsula, Brings Drought Relief Solution to California, with the Help of EcoloBlue and AWG Technology 2Health News:Food Handler Safety Certification Made Easy with Dynamic Path 2Health News:A new plugin was announced today, ProIntro Vol.3 from Pixel Film Studios for Final Cut Pro X 2Health News:Teenagers in Athens, GA are Locating Addiction Recovery Thanks to New Helpline 2Health News:Atlanta’s New Troubled Teen Helpline Is Making a Difference in the Community 2
Other Tags
hatchedmurreletmarbledswarmseelgrassisotronspaceswhiffiestdevicewidelyisraelilaunchvanasmebioengineerafraid