Tag: "warranted" at biology news

Research: Breast Cancer Gene Screening Not Warranted For All

...herited susceptibility tobreast cancer is just not warranted yet," Newman said. "It makes sense only invery select subgroups." A special concern is that women who carry a mutated form of BRCA1 may bedenied health or life insurance or jobs if it becomes known they are carriers,she said. Being a carrier ...

Susceptibility Genes For Nicotine Addiction

...neity LOD score of 2.63. To identify regions that warranted further study, we compared them to anempirical baseline, and found modest evidence for linkage on chromosomes 2, 4,10, 16, 17 and 18. These were investigated by additional genotyping of theChristchurch sample and by examination in an independent samp...

Perchlorate found in fertilizers

...lorate through the fertilizer-food chainpathway is warranted based on the results of this screening study."...

Aspirin targets key cell that triggers organ rejection and other immune responses, report University of Pittsburgh researchers in journal article

...as warnings to the T and B cells that an attack is warranted against a transplanted organ, or in the case of autoimmune disease, a patient's own tissue. The potential for an immune response is stopped in its tracks. The researchers also found aspirin to have a surprising effect on the precursor or progenitor...

Estrogen found in soy stimulates human breast-cancer cells in mice

...cal laboratory animal data suggest that caution is warranted regarding the use of soy supplements high in isoflavones for women with breast cancer, particularly if they are menopausal, said Helferich, who was the principal researcher on the papers. For most people, soy is a healthy food and can be used as part...

New research questions evidence for earliest life on earth

...n Earth remains elusive, and that great caution is warranted in working with samples of such antiquity. The difficulty of identifying life the earliest geologic record also has profound implications concerning our ability to recognize life in any Martian rock samples....

Pregnancy hormone estriol shows promise as multiple sclerosis treatment in first human trials

..., a larger, placebo controlled trial of estriol is warranted in women with relapsing remitting multiple sclerosis," Voskuhl said. "If larger studies confirm the benefits of estriol treatment, further studies for longer periods of time will be needed to determine whether estriol can decrease relapse rates and d...

Promising biomarker for melanoma is identified

... and if additional treatment with immunotherapy is warranted after the cancer is removed. Patients with early stage melanoma, called stage I cancer, have the thinnest lesions and are therefore the least likely to have a recurrence of their original cancer. The prognosis usually worsens as the tumor exten...

Changes in prevalence of mutations associated with HIV treatment failure

...low expected parallel trends. Further studies are warranted to directly show the relationship between mutations, antiretroviral therapy choices and clinical practices. The following trends were seen in mutations associated with resistance to the three classes of drugs included in the study: Wild-Type Wild-ty...

Science highlights of AAN Annual Meeting in Honolulu March 29 April 5

...rial of antibiotic treatment of such infections is warranted because it may help mitigate disease exacerbation in some patients. Epilepsy For many patients with epilepsy, surgery that removes pat of the temporal lobe (a portion of the brain above and in front of the ear) effectively reduces the number and s...

Age, race and gender influence kids and teens beverage choices

...ring of children's beverage intake is nevertheless warranted because caloric contributions must be balanced with energy expenditure. In addition, consumption of milk should be encouraged through continuation of strong promotional efforts, but most importantly, through parental role models. But policies aimed...

Articles on protected area management published in BioScience

...Nature. The approach highlighted five threats that warranted concerted policy efforts: poaching, alien plants, tourism, logging, and encroachment. Five critical management issues that emerged were funding, staffing, research and monitoring, resource inventories, and community relations. An article by Peter S. ...

Moderate alcohol consumption after meals can decrease levels of insulin

...n production under variable nutritional conditions warranted investigation." Researchers examined eight non-diabetic males between the ages of 19 and 22 years. All were required to consume pizza and a soft drink for 45 minutes, and then slowly drink three standard units of white wine (10 grams of alcohol each...

Research to create lung-cancer blood tests receives $3.4M in Pennsylvania tobacco settlement funds

...d treating periodontal disease during pregnancy is warranted to reduce preterm births. Temple University and its collaborators, Lancaster General Hospital, Philadelphia College of Osteopathic Medicine, University of Pittsburgh, and the Western Pennsylvania Hospital, will determine why African-Americans and ...

Kinase backgrounder: Iressa discovery part of major kinase project at Dana-Farber

...With this distinctive abnormal kinase, the disease warranted a new, specific name: mixed lineage leukemia. As with the case of CML and Gleevec, inhibitors already existed -- four of them, in fact -- for this kinase. Today, one inhibitor-based treatment is already in clinical trials, showing activity against a ...

The search for a safer smallpox vaccine: New data released on promising candidate

...f both studies suggest that additional studies are warranted to further evaluate the efficacy of the vaccine candidate," Buller said. VaxGen plans to begin a Phase I/II trial in humans later this year to study LC16m8's safety and ability to induce an immune response. VaxGen also intends to initiate a large-sca...

New prostate cancer gene identified

...aper's senior author. "Much additional research is warranted to determine the extent of its involvement in prostate cancer and other cancers as well." "These findings represent a significant advancement in prostate cancer research, as the number of current treatment options for advanced prostate cancer remains...

1

(Date:4/18/2014)... scientists could lead to potential new treatments for breaking ... , Fibrosis, or scarring, is a hallmark of ... lungs can lead to serious organ damage and, in ... options centers on findings made by Swati Bhattacharyya, PhD, ... that a specific protein plays in promoting fibrosis. ...
(Date:4/17/2014)... popular vaccine brands for children may not be the ... cost factors when choosing vaccines, driving the market toward ... a new study by University of Illinois researchers. , ... by numerous factors," says Sheldon H. Jacobson, a co-author ... and of mathematics at the U. of I. "In ...
(Date:4/17/2014)... NY In a review published in the April ... president of The Feinstein Institute for Medical Research, says ... medical community,s approach to treating sepsis, which ... Americans. , Sepsis occurs when molecules released into the ... throughout the body. Inflammation is necessary for maintaining good ...
(Date:4/17/2014)... many as 10 million older Americans suffer from depression, ... , However, new research a project that followed ... six years found that Internet use among the ... than 30 percent. , "That,s a very strong effect," ... telecommunication, information studies and media who led the project. ...
(Date:4/17/2014)... 17, 2014 EcoHealth Alliance, a nonprofit organization that ... a comprehensive review today examining the current state of ... review calls for improved global surveillance strategies to combat ... outbreak of Ebola in West Africa that has claimed ... Guinea and Liberia. According to the World Health ...
Breaking Medicine News(10 mins):Health News:New clues on tissue scarring in scleroderma 2Health News:Study recalculates costs of combination vaccines 2Health News:Feinstein Institute researcher publishes new perspective on sepsis 2Health News:Internet use can help ward off depression among elderly 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 2Health News:Re-emergence of Ebola focuses need for global surveillance strategies 3
Other Tags
pandoraswettergrasslandsleftieshygieniccapacitiesmusculaturemirnasawaresummitkyotoesabrachytherapyinversetemporarilysue