Tag: "wave" at biology news

Envisat concludes a busy second year in orbit

...ng Track Scanning Radiometer (AATSR)." RA-2 ocean wave height data plus Envisat ozone measurements - get...(ECMWF), with plans to make additional use of ASAR wave mode in future. ASAR homes in on earthquake zones; The improved amount of data returned by Envisat ...

Optically recording millisecond brain nerve impulses

...les of uniform polarity produces a second-harmonic wave of twice the energy -- or half the wavelength -- which is easily detected by the microscope in the forward propagating direction. Thus, every change in polarity and every action potential is optically imaged in submicrometer and millisecond spatiote...

Computer scientists develop tool for mining genomic data

... challenge - determining how to analyze this tidal wave of data. Stanford Associate Professor of Computer Science Daphne Koller and her colleagues have come to the rescue with a strategic approach that reduces the trial-and-error aspect of genetic sequence analysis. ''What we're developing is a suite of c...

Scientists' findings may lead to better understanding of how that sleep develops, matures

...rapid eye movement sleep (AS/REMS) decreases. Slow wave sleep becomes predominant in the first part of the...tiate between stage 1 (S1), stage 2 (S2), and slow wave sleep (SWS). Thus, the scoring criteria resembled those used in adults. A sleep cycle was defined a...

New evidence suggests that monkey thought extinct still exists

.... "Its extinction may represent the beginning of a wave of extinctions which will make their way across this part of Africa," McGraw said. "There could be a cascade of disappearances, including all of those animals that are dependent on high-canopy forests. "Since there's very little canopy area left, thi...

Thailand dengue hemorrhagic fever epidemics spread in waves emanating from Bangkok

...d that the disease radiates outward in a traveling wave from Bangkok, the nation's largest city, to infect...to the researchers' analysis, the spatial-temporal wave travels at a speed of 148 kilometers per month and takes about eight months to spread through the en...

Human migration tracked in Stanford computer simulation

...ation itself remained most common in the migratory wave front, a situation Cavalli-Sforza refers to as "surfing" the migratory wave. Over the course of 64,000 simulations, the group came up with a model for finding a mutation's origin. First they identified the mutation's farthest edge - corresponding wit...

Space technology in new technique to fight breast cancer

...ady advanced medical product." ESA's expertise in wave propagation modelling has been essential in getting the two MRI and HIFU technologies to work optimally together. The modelling allows a fast simulation of the ultrasound transducer settings to inspect the effects prior to actual treatment. Usually ...

Exxon Valdez oil spill impacts lasting far longer than expected, scientists say

... was sequestered in conditions where weathering by wave action, light and bacteria was inhibited, and toxicity remained for a decade or more." As a result, many species suffered long-term loss, he said. For example, chronic exposure to the oil in mouths of streams boosted mortality among incubating pink s...

Scientists discover how anthrax creates its deadly spores

...truction of the sporedidn't begin until the fourth wave of gene expression. According to Hanna, this sugg...ates that proteins produced during the large,fifth wave of gene expression also become part of the spore itself.These include enzymes the spore needs for ra...

Shyness can be deadly

...es striking a stone on the beach," Cole said. "One wave won't do much damage. But the constant pounding of waves eventually grinds that stone to sand. That's how continual stress response wears down the immune system." Previously the UCLA team found that the body under stress releases a chemical called no...

Little-studied waves in the heart may be cause of defibrillation failure

...death. "In normal conditions, an electrochemical wave moves smoothly across the heart, like expanding ripples in a lake when you toss in a stone. This wave then triggers a smooth and orderly contraction of the muscle," Wikswo, the Gordon A. Cain University...

Nutrient-poor oceans generate their food 'hot spots'

...rs by mixing. In the convergence zones produced by wave movements, there would not be any new production o... as a wave-guide. In the tropics two main types of wave can be distinguished: Kelvin waves, which propagate from West to East along the Equator, and Rossby ...

Philippines: Park expansion creates nation's largest contiguous protected area

... Philippines could be the site of the world's next wave of extinctions. Today's announcement, however, gives us reason for hope and we applaud the government for taking this bold measure."...

'Dog-on-a-chip' could replace drug-sniffing canines

...s sensitivity is achieved through surface acoustic wave (SAW) electronics, a method of detecting a chemical by measuring the disturbance it causes in sound waves across a tiny quartz crystal. This is a fairly common analytical method, and it has been used in other electronic noses, but by itself it does n...

SPR Annual Meeting features newsworthy discoveries

...m children with ADHD show that they have more slow wave brain activity than children without ADHD. Drugs l...in effect to caffeine and cause a decrease in slow wave activity which, paradoxically, helps these children calm own. However, a small group of children wi...

Tufts scientist named 'one of world's 100 top young innovators' by Technology Review Magazine

...e that there is no one technology driving the next wave of success, but rather several that, when fused together, will create another era of significant change for our society. The members of this year's TR100 hail from fields such as nanotechnology, biotechnology, wireless, energy, computing and medicine...

More than 700 threatened species remain completely unprotected, new study shows

...e protected area system, scientists expect a major wave of extinctions within the next few decades. The "global gap analysis" provides an overview of how well the world's species are covered by the global network of protected areas. The study was released by the Center for Applied Biodiversity Science (CA...

Physics tip sheet #37

...ew Letters (Published online: August 28, 2003) The wave nature of biomolecules has been shown for the first time in tetraphenylporphyrin (TPP) and quantum interference has been shown for the largest molecules yet. These experiments showed that when the molecules passed through two slits, they formed inter...

Fishing for photos of rare or unknown deep-sea creatures with an electronic jellyfish lure

...jellyfish sometimes respond by creating a circular wave of light around their outer edge that progresses like the lights on a movie marquis. Scientists call this a "burglar alarm" response and theorize that jellyfish use it to attract large animals in to eat whatever animal is attacking the jellyfish. To ...

1 2 3 4 5 6 7 8 9

(Date:4/17/2014)... PLOS Pathogens , children who live in regions of ... immune response to infection with malaria parasites that may ... and illness and partially control the growth of malaria ... develop future interventions that prevent or mitigate the disease ... 200 million cases of malaria occur worldwide, resulting in ...
(Date:4/17/2014)... Two recent papers by a University of Colorado ... scientists develop treatments or vaccines for Dengue fever, ... other disease-causing flaviviruses. , Jeffrey S. Kieft, PhD, ... the School of Medicine and an early career ... colleagues recently published articles in the scholarly journals ...
(Date:4/17/2014)... biology team has created a new technology for ... could travel the body and selectively target cancer ... biological devices that monitor and modify human physiology ... However, no existing technology enabled bioengineers to build ... and respond in a customized fashion. , "The ...
(Date:4/17/2014)... estimated that as many as 10 million older Americans ... loneliness and isolation. , However, new research a ... older Americans for six years found that Internet ... depression by more than 30 percent. , "That,s a ... University professor of telecommunication, information studies and media who ...
(Date:4/17/2014)... 17, 2014 By discovering a new mechanism that ... stroke, researchers at UC Irvine and the Salk Institute ... limit or prevent stroke-induced brain damage. , A complex ... of death and primary reason for disability in the ... stroke and lets blood-borne material into the brain, causing ...
Breaking Medicine News(10 mins):Health News:Study sheds light on how the immune system protects children from malaria 2Health News:CU researchers discover target for treating dengue fever 2Health News:Building 'smart' cell-based therapies 2Health News:Internet use can help ward off depression among elderly 2Health News:Study IDs new cause of brain bleeding immediately after stroke 2
Other Tags
architectsbeaverrunawaycaspaseclindamycinplentifulpertussisimmunogenicityallergenillnessessupplementsherbalprofessorshipbassetspaceddocument