Tag: "wealth" at biology news

World's Experts Plan Global Locator Service For Environmental Information

... "We now hold around the world an incredible wealth of information about the Earth and its inhabitants," the Vice President said. "That information could have a profound impact on our ability to protect our environment, manage natural resources, prevent and respond to disasters, and ensure sustainabl...

UT-Houston Awarded $2.5 Million For Scleroderma Research

...her three talented research groups. To have such a wealth of expertise focused on revealing the genetic andenvironmental basis of the disease is a truly exciting prospect." Commenting on the news that UT-Houston has been selected as the firstSCOR in scleroderma, President M. David Low said: "The NIH...

Colorado State Anthropologist Finds Fossil Treasures In Africa

...and earlier. "This is a great find because of the wealth of fossils in the cave," Waddle said. "It's particularly important because Botswana hasvirtually no fossil sites of this kind and there really is no fossil record of primates at all. Many fossil sites may only produce a fewfossils. "This is really i...

Biologist Experiments With His Own Front Yard

...ay in the yard and flowerbed. "There's such a wealth of natural history out there, even in your yard," Alcock said, "All I'mreally doing is acting as a translator to give these stories a broader hearing than they would getotherwise." Alcock has a knack for drawing the reader into the otherwise un...

Summary Of USGS Presentations And Activities, AAAS, 1998

...cture (NBII), a computerizedconnective linking the wealth of biological information resources availablethrough the Internet. As the nation's largest water, earth, and biological science and civilianmapping agency, the USGS works in cooperation with more than 2000organizations across the country to provide r...

Cystic Fibrosis Foundation Launches Innovative Therapeutics Development Centers

...ork was created to capitalize on the increasing wealth of information uncovered by Foundation-supported scientists about the basic defect in CF. By establishing specialized clinical centers, researchers can seize these opportunities to intervene in the disease process through promising new CF tr...

American Society Of Gene Therapy To Hold Its First Annual Meeting

...ience with outstanding clinicalinvestigation and a wealth of educational opportunity," said Dr. GeorgeStamatoyannopoulos, president of the society and professor of genetics andmedical genetics at the University of Washington. More than 1,500 scientistsfrom the United States and overseas are expected to atte...

USGS To Study Young Forests And Streamsides In Western Oregon

...management practices. "The Pacific Northwest has a wealth of diverse plant and animal life andhabitats," said Dr. Michael Collopy, director of the USGS Forest and RangelandEcosystem Science Center in Corvallis, Oregon. "Our studies of thesecommunities--especially in young forests and streamside areas--will ...

As The City Goes, So Goes The World: Symposium At ESA Meeting To Examine The Ecology Of Cities

...hrough these projects will be added to the growing wealth of urban ecological data being developed at theCAP LTER via its website. The social, economic, physical, and ecological complexity of cities requiresmulti-disciplinary efforts to understand urban areas. Ecologists have thetheoretical foundations and...

Cubist Pharmaceuticals Describes New VITA™ Technology For Enabling Genomics For Drug Discovery

...ed a new technicalchallenge of how to harvest this wealth of information for drug discovery," saidScott M. Rocklage, Ph.D., President and Chief Executive Officer of Cubist. "Werecognized early on that innovative technologies would be needed to overcome therate-limiting steps between protein identification...

Jurassic Beetle: CSIRO Entomologist Discovers Living Fossil

...g proof that Australia still harbours an enormous wealth of ancient animals and plants which remain unknown and undiscovered. "After the discovery of the Wollemi pine, near Sydney, I'd expect to find anything anywhere," he says. In fact, Dr Lawrence adds wistfully, it would be interesting to study...

Researchers Link Gene Defects To The Course Of A Deadly Form Of Heart Disease

... QT patients,Moss says. "Our hope is that the vast wealth of geneticinformation being mined through the Human Genome Project can beused in a similar fashion."...

Glenn To Perform Purdue Soybean Experiment In Space

...ever been performed in microgravity. There isn't a wealth of background information for us to go to and say this may happen, or this might not happen. Things may not go as we expect, so we can't get too excited yet," he says. The seeds will be returned to Purdue and cultivated in greenhouses. The progeny of...

Large Gene Study Questions Cambrian Explosion

... "Not only are all these genes telling us that a wealth of animal species in atleast three phyla were already on Earth millions of years before their fossilsstart appearing," Hedges says, "but they also are telling us when three of themajor kingdoms of living things--animals, plants, and fungi-- first div...

Future Of West Tied To Saving, Not Extracting, The Land

...kes an ironic twist to thefrontier axiom that "all wealth comes from the land." William Freudenburg says western towns that are healthiest today are those thathave stopped chasing new mines, smokestack industries and prisons and focusedinstead on the west's greatest asset, its natural beauty. Many rural to...

Household Fungus Contributes To "Sick Building Syndrome"

...s." Since plantpathologists and mycologists have a wealth of expertise with fungi and moldsthey are able to help educate the public about home and building molds andspecifically, the possible dangers of S. chartarum. "The fungus is commonly found in homes or buildings which have sustainedflooding, or water...

INDOEX Researchers Document The Impact Of Pollutants On Climate Processes Over The Tropical Indian Ocean

...European pollutionparticles. INDOEX will provide a wealth of important and unique data for globalclimate modeling purposes to assess the impact on climate. These measurements in the Indian Ocean are also important because theycharacterize emissions from the rapidly emerging economies in this region. Wemight...

Taking The Animal Out Of Animal Testing

...has given his company a business boost. Hesays the wealth of new ideas from the constant influx of energetic studentscreates a dynamic positive atmosphere in which to do business. The units, which retail at about $40,000 apiece, are in use in Japan, Germanyand Taiwan, as well as in several U.S. Universities...

A 'Missing Link' Fossil Adds 'Foliage' To The Early Human Ancestor Family Tree

...asingly, the focus on African early hominid fossil wealth hascentered on Ethiopian sites in contrast to the last few decades' focus onbetter-known productive sites in Tanzania, Kenya and elsewhere. "With thepublication of these new results, and with a record spanning five million years,Ethiopia's Middle Aw...

Invasive fishes pose increasing threat to U.S. waters and native fishes, says USGS

...into Inland Waters of the UnitedStates, provides a wealth of current information on the status and impacts ofnon-native fish in America's waterways. For example, the authors write, non-native fish species are causing declines inthe abundance and genetic integrity of native fish species -- including highlyv...

1 2 3 4 5 6 7

(Date:5/18/2013)... May 18, 2013 Spectrum Surgical ... on May 17-22 in Austin, TX where thousands ... educational and networking opportunities. , Spectrum Surgical/STERIS ... flexible scope repair capabilities and certified pre-owned ... educational information on proper instrument care of flexible ...
(Date:5/18/2013)... Irvine CA (PRWEB) May 18, 2013 The ... Scrum classes are scrum framework, scrum roles, scrum meetings, scrum ... development units (8 PDUs) for attending them. , These trainings ... directors. It is also ideal for those who will be ... industry or those who want to explore Agile and Scrum, ...
(Date:5/18/2013)... Wine World Accessories, a renowned online ... an attractive 25% discount on Franmara Dynamo Electric ... now purchase this electric corkscrew opener for $44.95 via ... The online store ensures delivery of their items within ... , A spokesperson from the online store elaborates ...
(Date:5/18/2013)... CA (PRWEB) May 18, 2013 ... latest update to consumers about transvaginal mesh ... federal court Resource4thePeople reports that plaintiffs have ... to court documents. , The rulings came ... District Court in the Southern District of ...
(Date:5/18/2013)... 2013 Medical device company, FlexLeg, LLC, last ... anticipated mobility aid with its namesake, the FlexLeg. The ... crutch alternative that injured individuals can use to walk ... can remain active and walk during a typical 6-8 week ... system to ensure those who need the device most are ...
Breaking Medicine News(10 mins):Health News:Spectrum Surgical Attends Society of Gastroenterology Nurses and Associates' (SGNA) 40th Annual Conference in Austin, TX 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 2Health News:Affordable Scrum Trainings In Irvine by Conscires Agile Practices 3Health News:Now Save 25% on Franmara Dynamo Electric Wine Bottle Opener at Wine World Accessories 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 2Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 3Health News:2013 Alleged Transvaginal Mesh Complications Lawsuits Update: Resource4thePeople Reports Defendants Ordered to Provide Testimony, Documents 4Health News:FlexLeg Begins Offering New Mobility Aid 2
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan