The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "worms" at biology news

Researchers develop fast track way to discover how cells are regulated

... in common with humans. She explains that although worms appear simple, the worm genome is comprised of 20,000 genes. The human genome has over 30,000 genes. "When you look at the numbers, it becomes very clear that the old way -- studying one gene at a time -- is too slow. It becomes a problem of scale, w...

Convulsions in worms mimic epileptic seizures

..., Cody J. Locke and Andrea L. Braden. They studied worms with a mutation in the LIS1 gene. In its human for...stems seemed to be organized correctly, the mutant worms were more susceptible to epilepsy-like convulsions than normal worms. To induce convulsions, the r...

Heartless worms hold clues to cardiac arrhythmias, sudden death

...3 pharynx has long stretches of pauses, "as if the worms are having an arrhythmia." The team developed a method to quantitate the pauses and demonstrated that "knocking out" the unc-103 protein using a technique called RNA interference restored normal pharyngeal pumping. The investigators reasoned that if...

Revealing bizarre deep-sea secrets

...rd site is a community of chemosynthetic clams and worms that rely on methane-eating bacteria for nutrition. The worms are plentiful around the seeps and attract a number of predators such as fish and deep-sea sharks. ...

Whale carcass yields bone-devouring worms

...nounced the discovery of two new species of unique worms that feed on the bones of dead whales. In the July...s differ from those of any other known animal. The worms have no eyes, legs, mouths, or stomachs, but they do have colorful feathery plumes and green "roots....

Environment influences learning: U of T study

...haviour accordingly. The researchers first placed worms on agar plates treated with a salt medium, exposed... you had first learned it. "During training, the worms learn about whether smell predicts starvation, and it becomes apparent that environmental cues can a...

Oxygen sensing in worms may hold key to healthy blood pressure in humans

...odes in the laboratory are routinely kept. But the worms actually much preferred oxygen concentrations of o...ering and clumping," in which large numbers of the worms gather around the border of a Petri dish. "Bordering and clumping turns out to be a laboratory artif...

UCSD biologists discover cell's defense mechanism against class of disease-causing bacterial toxins

... the toxin doesn't recognize human cells, it hurts worms in a manner similar to the pore-forming toxins tha...iochemical and genetic mechanisms that allowed the worms to do this. Huffman and Roman Sasik, a postdoctoral fellow working with Jacques Corbeil at UCSD's m...

Researchers discover how worms' noses sense oxygen

...ering and clumping is a peculiar behavior in which worms cluster around the border of the Petri dish instea...l Research (QB3), determined that the bacteria the worms feed on are at a higher density around the border of the dish, consuming oxygen along with the worms...

Gene alteration points to longevity, thinness

... gene activity level in their animal model. "These worms reflect what happens with reduced activity in the ...s. To confirm that the gene functions similarly in worms and humans, they also plan to take the Indy gene out of the C. elegans and replace it with the human...

Drunken worms reveal a genetic basis of alcohol response

...ies and his colleagues exposed two wild strains of worms -- one from England and one from Hawaii to alcoho...their movement became after exposure. The Hawaiian worms showed a more dramatic recovery from initial intoxication than did the English worms. Genet...

'Male-killer' bacterium's genome is deciphered

...riasis (diseases such as elephantiasis), since the worms that cause filariasis require the endosymbiotic Wolbachia for survival....

'Male-targeting' bacterium's genome is deciphered

...antiasis, and other human diseases caused by small worms (such as Brugia malayi) that cannot survive/reprod...eproductive cells, it is possible to also kill the worms that cause those diseases. For example the genome analysis identified many genes that likely play ro...

UCSB discovery may accelerate new treatment for global health problem

...nes or urinary bladder. The adult male and female worms pair, mate, and produce large numbers of eggs, som...ld be halted. The presence of the nonreproductive worms may also help infected people keep their immunity to reinfection....

UC Santa Barbara donates discovery to OneWorld Health that may speed disease treatment

...nes or urinary bladder. The adult male and female worms pair, mate, and produce large numbers of eggs, som...ld be halted. The presence of the nonreproductive worms may also help infected people keep their immunity to reinfection....

Biochemical clues to long lifespan revealed

... findings extend longevity research from yeast and worms into mammals, and suggest that longer life results...rnal Science. Previous studies in yeast and worms pinpointed a gene known as Sir2 as a key regulator of lifespan: deleting Sir2 limits lifespan, and e...

Study in worms shows how genes linked to complexity in animals

...tis species also have this gene lin-48 but these worms don't express it like C. elegans does. As a result, the other worms died when exposed to the same levels of salt. Somewhere along the evolutionary pathway...

New roles for protein modifications in cell migration

...e migrating gonadal tip cells. Distal tip cells in worms engineered to lack the MIG -17 protein fail to steer cell migration properly, resulting in abnormal development and a emeanderingf gonad phenotype. However, the means by which MIG-17 coordinates the timing and direction of the developing gonadfs prog...

Scientists identify molecular step that causes intoxication

... throughout the animal kingdom, since species from worms and fruit flies to mice and humans all become into... slo-1 gene, the scientists were able to show that worms lacking this one gene were virtually unaffected by alcohol, often behaving normally even when expose...

Ability to smell food regulated by enzyme's interaction with RNA interference pathway

...al defects, according to Bass. For example, mutant worms that lack ADARs have trouble finding food. When placed near food a normal worm crawls quickly to the food but an ADAR mutant may crawl in a completely different direction. To see if ADAR functions were related to the RNAi pathway, Bass and Tonkin mad...

1 2 3 4 5 6 7

(Date:12/1/2008)... American Board of Medical Spe... the certification of physician specialists in the...A, as the organization’s new chief operating... EVANSTON, Ill. (Business Wire EON) De...experience working in various industries including...
(Date:12/1/2008)...SBURG, Pa., Dec. 1 /PRNewswire-USNewswire/ -- As...Acting Secretary of Health Everette James today ur...s that causes AIDS. He also highlighted ongoing ef...how it is prevented. , , "Our message is cl...ethnicity or race, being tested for HIV is the onl...
(Date:12/1/2008)...mography and sonography findings help doctors iden... according to a study performed at the University ...mage findings from 57 male patients who were diagn...tudy. "The findings show that breast cancer in men...rregular shape and spiculated (spiky or pointy) ma...
(Date:12/1/2008)...onary CTA offers a low cost, non-invasive alternat...ients who are suspected of having coronary artery ...coronary artery plaques, according to a study perf... Philadelphia, PA. , The study included 31 patie...plaques that were discovered during coronary CTA. ...
Breaking Medicine News(10 mins):Health News: ABMS Appoints Margaret Jung As New COO 2Health News:PA Department of Health Recognizes 20th Anniversary of World AIDS Day; Urges HIV Testing 2
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs