Tag: "writes" at biology news

Obesity not a personal failing, but a battle against biology

...ject until we resist the impulse to assign blame," writes Friedman, who led the laboratory team that discovered the obesity hormone leptin in 1995. "Nor can we hold to the simple belief that with willpower alone, one can consciously resist the allure of food and precisely control one's weight. "Instead, we ...

Intelligent device shows promise in physical activity measurement market

...rate results ever reported for a portable device," writes Elizabeth DeRobertis, a contributing analyst to Nutrition Research Newsletter. "The scientific information it generates is invaluable in assessing physical performance and diagnosing a variety of diseases. The device is expected to find a strong foot...

New book entertainingly tells 'What Good Are Bugs'

...eds the harm done by the few destructive ones," he writes early on. Waldbauer retired in 1995. He has since written "Millions of Monarchs," "Bunches of Beetles," "Insects Through the Seasons" and "The Birder's Bug Book." Meredith Waterstraat, a former Illinois graduate student in mathematics education and ...

Roads pave the way for weed invasions

...ue of the journal Ecological Applications, Gelbard writes with a UC Davis professor of environmental science and policy, Susan Harrison, about roads' effects on inland California foothill grasslands. Gelbard and Harrison found that in areas with typical grassland soils, non-native plants were less abundant ...

No detectable risk from mercury in seafood, study shows

...ncet, Johns Hopkins scientist Constantine Lyketsos writes that, "For now, there is no reason for pregnant women to reduce fish consumption below current levels, which are probably safe." He calls the Seychelles study a "methodological advance over previous studies." Questions about the health effects of me...

Perfect planet, clever species

...p through the history of the universe." "[Burger] writes with the clarity and humor of one who has had experience communicating complicated ideas to the lay public," says the Boston Globe. The book argues that there is probably life elsewhere in the Milky Way, but something more like "green slop" than int...

Scientists predict swift end to vCJD epidemic

...f secondary transmission remains a high priority," writes Ghani. Furthermore, the scientists only calculated how many deaths would occur among the group of people who are most susceptible to catching the disease. Two natural variants of the prion protein gene exist, one of which seems to confer a higher ri...

UCLA study finds clues to diabetes puzzle

...stimated minimum of half-a-billion cases," Diamond writes in the June 5 Nature article. The findings relate only to type II -- or so-called adult-onset -- diabetes, a form of resistance to insulin, the human hormone responsible for controlling blood sugar. When left unchecked, elevated levels of blood sugar...

Rb2 gene may play role in determining effectiveness of drug therapies against breat cancer

...are writing the sentences, and this finding really writes a very important sentence in the book that we are authoring on uncovering the understanding of how a normal cell functions and why some therapies work or some therapies don't work. "It also clearly shows that cancer is not the event of one gene, but...

Sepsis drug fights infection, decreases hospital care over two year study

...nificant even at two-year followup evaluation. Ely writes in the study, "Although older ICU patients could potentially require more interventions and consume more health care resources, recent studies have shown that older patients actually receive less-aggressive care than do younger patients." Age will c...

By the year 2050, human population could add 2.6 billion people, reports Rockefeller scientist

...tal population of the world in 1950 will occur. So writes Joel E. Cohen, Ph.D., Dr.P.H., professor and head of the Laboratory of Populations at The Rockefeller University and Columbia University, in a Viewpoint article in the November 14 issue of the journal Science. In "Human Population: The Next Half-Cen...

Three personal ads for physics

...ootball to tackle public fear of physics. Gay also writes and appears in television programs that familiarize viewers from around the world with the game of American football. He is one of the "pop physics" experts appearing at the American Association for the Advancement of Science (AAAS) Annual Meeting. C...

Scientists, lawyers discuss decision-making amid uncertainty

.... "Scientists invite such trouble unwittingly," he writes in a 2002 American Scientist article. "We often project the appearance of being locked in unending debate." To counteract this tendency, Schneider encourages scientists to present seminars that "stress what is indeed well established before we lapse ...

Sarah Staples and Daniel Grossman win 2004 AIBS media awards

...orporation, and Germany's Deutsche Welle radio. He writes regularly for Scientific American. Dan's journalis...al military and civilian science agencies. He also writes about patent law, marine biology, and ecological issues. A former freelance journalist, he has writt...

Gene required for formation of blood cells

... target genes, or a specific subset of HOX genes," writes Dr. Korsmeyer....

New, comprehensive tumor classification combines molecular biology and classic pathology

...assembling data under sensible group hierarchies," writes Berman. "The most important value of this (new) classification is the disengagement of tumor type and tumor place of originThis permits tumors with similar molecular profiles to be classified according to biological attributes rather than anatomical ...

Improved crop production and fewer greenhouse gases

...t can helpmitigate the effects of global warming," writes Harrison and his co-authors. "Switching from a conventional till method to conservation tillage couldproduce 15% more food on the same amount of land," according to the authors. This has serious implications, they write, as the "global population con...

'Telling people what they want to believe'

...ns diet and other similar diets." Ornish writes that he and Atkins diet creator Robert Atkins agre...high-fat diets on blood cholesterol. Ornish writes that health professionals should educate their clients and patients to develop a diet that is high i...

UF researcher: Animals think in their own way, but unlike humans

...y of Florida psychology Professor Clive Wynne, who writes about these creature features and others in a new 244-page book, "Do Animals Think?" being published this month by Princeton University Press. While animals can do many clever things and even reason, they don't have the ability to reflect on what...

Bye-bye Bio 101: Teach science the way you do science

...ess improves learning and retention of knowledge," writes lead author Jo Handelsman, Howard Hughes Medical Institute professor and plant pathology researcher at the University of Wisconsin-Madison, in a policy forum article published in the April 23, 2004, issue of the journal Science . Handelsman and her ...

1 2 3 4

(Date:8/21/2014)... (PRWEB) August 21, 2014 Recently, ... among their patients. Alternative medicine is on the ... to millenials. According to The Fiscal Times, young ... treatments over conventional medicine. , The Fiscal Times ... many millenials are embracing alternative medicine. The article ...
(Date:8/21/2014)... with advanced laryngeal cancer appear to have better ... nonsurgical chemoradiation. , Author: Uchechukwu C. Megwalu, M.D., ... Mount Sinai, New York, and colleagues. , Background: ... are diagnosed each year and squamous cell carcinoma ... Prior to 1991, total surgical removal of the ...
(Date:8/21/2014)... NC -- Researchers have pinpointed the environmental source of ... Southern California for decades. It literally grows on trees. ... of a 13-year-old girl, who spent the summer gathering ... hardest hit by infections of the fungus named ... Cryptococcus , which encompasses a number of species including ...
(Date:8/21/2014)... (HealthDay News) -- Not only is eating better and exercising ... of health-care dollars a year, a new study finds. ... health sciences at Wake Forest Baptist Medical Center in Winston-Salem, ... 2 diabetes patients. Participants ranged in age ... an intensive "lifestyle change program" focused on diet and exercise, ...
(Date:8/21/2014)... The W. Montague Cobb/ NMA ... national voice in the elimination of health disparities, ... the 112th National Medical Association’s (NMA) Annual Convention ... John Ruffin, Ph.D, former Director of the National ... life-long career and innovations have had a significant ...
Breaking Medicine News(10 mins):Health News:Van Uden Center Sees Growth in Alternative Medicine 2Health News:Surgery associated with better survival for patients with advanced laryngeal cancer 2Health News:Fungus deadly to AIDS patients found to grow on trees 2Health News:Getting Healthier a Big Money-Saver for People With Diabetes 2Health News:W. Montague Cobb/NMA Health Institute Honors Three Outstanding Leaders in Health Disparities 2
Other Tags
titantedstinkyhypertensivesdiesellaybeachremovesaceseekpreliminarymitralagesfactquotationsretarded