Tag: "disabling" at biology news

Interactive health information system to detect Japanese encephalitis in Asia

...veillance and response. Japanese encephalitis is a disabling and often fatal mosquito-spread disease that mostl...ctive vaccine to eventually rid the region of this disabling and deadly disease. The Voxiva system is able to quickly spread the word about new vaccines as they ...

Researchers discover gene mutations for Parkinson's disease

...tions that could actually alter the course of this disabling disease." The gene, PARK8, encodes a protein named dardarin by the researchers, from the Basque word dardara, which means tremor, a major symptom of Parkinson's disease. It was isolated on chromosome 12 by investigators who studied five families with...

Pesticides may promote Parkinson's disease and exercise may offer protection

...erstand some of the mechanisms of this serious and disabling brain disorder, which affects about 1 million people in the United States. Knowledge of the environmental factors and genetics of this illness has allowed investigators to create models of disease that are being used to examine potential causes of ne...

Scientists first to grow common cause of food poisoning in the lab

...as an equivalent in human noroviruses, altering or disabling it may give us a way to produce forms of the viruses that are weak enough to serve as vaccines." According to the U.S. Centers for Disease Control and Prevention, noroviruses are involved in about half of all food poisoning cases and annually cause ...

Despite causes of lupus proving complex, critical 'checkpoint' suggesting new therapy is revealed

... patients could cure the disease's aggravating and disabling symptoms. "The immune system is a balance between too much and too little," says Ravetch. "We're seeing the inhibitory Fc receptor on dendritic cells, another immune system cell type, may play a similar role in other illnesses. We may reach a conver...

TGen and Kronos initiate Alzheimer's disease study

...nt of Alzheimer's disease, the most common form of disabling memory and thinking problems in older persons. Using cutting edge technology, researchers at TGen will survey 570,000 letters of the genetic alphabet (commonly known as "SNPs") in the DNA of 1,000 deceased persons confirmed to have Alzheimer's diseas...

New tumor-suppressor gene discovered

... kinds of tumors. These studies indicate that the disabling of this one gene alone can cause the growth of tumors. The researchers then did a number of experiments to study this line of flies with the clearly defective mats gene. "With transgenic techniques, we were able to introduce a normal mats gene int...

Salk polio vaccine celebrates 50th anniversary

...s, children, and adults from many other deadly and disabling infectious diseases. The mobilization of the nation to raise money to fight polio introduced philanthropy and volunteerism into the daily lives of millions of Americans for the first time. From Polio to Prematurity: the March of Dimes Today Follo...

Carnegie Mellon and U. of Pittsburgh create tool to understand neuron rhythms, learning

...ctivity lead to learning, while others can trigger disabling disorders like epilepsy. Specifically, the study investigators developed a method to calculate the phase-resetting curve (PRC) of living neurons. Like a translation key, a PRC dictates how a given neuron will change its routine firing pattern in res...

Managing maternal depression during pregnancy presents significant challenge to clinicians

...-Kolko said. "Until we know more, treatment of the disabling disorder of depression must be a primary consideration."...

Geneticists identify 'master switch' that causes female flies to behave like males

...-step courtship ritual. Last year they showed that disabling the fruitless gene in a tiny group of cells in the brain of a male fruit fly was enough to prevent successful mating, by turning him into a bumbling, ineffective suitor. In the new study, researchers asked whether the fruitless gene would be enough t...

UQ among world leaders in schizophrenia research

...nd 90,000 Australians. Schizophrenia is a severe, disabling brain disease with its onset usually in early adulthood, and symptoms include unshakable false beliefs, hearing voices, incoherent speech and the breakdown of normal thought processes and emotions. "Evidence from family, twin and adoption studies cl...

New bipolar survey: Patients' satisfaction influenced

...control the manic symptoms but also treat the more disabling depressive symptoms," comments Michael Grinter, SEROQUEL patient and Thinking Ahead Taskforce member. "The treatment that I am currently taking, SEROQUEL, has brought an enormous benefit to my life in terms of controlling both poles of my mood and ha...

New research bolsters highly targeted gastro-intestinal cancer treatment

...orks by also binding to this KIT receptor and thus disabling its activity. As a consequence, the GIST cells stop growing and even die off. In contrast to chemotherapy or radiation treatment, Glivec is a highly targeted drug without many side effects. The problem is that often the tumor cells adapt themselves s...

Folic acid link with low birth weight, shows pioneering study

...hey have a 50 per cent chance of having a severely disabling condition as a result of being too light. Healthy birth weights are a marker for good health in infancy and later life. Researchers say that current NHS policy is to advise women to take folic acid at their first pregnancy check-up but this means tha...

Brain activity in youth may presage Alzheimer's pathology

...the same as those that, later in life, exhibit the disabling clumps of plaque characteristic of Alzheimer's, a disease that most frequently manifests itself after age 60. That remarkable correlation, said Buckner, suggests that dementia may be a consequence of the everyday function of the brain. "It may be the...

New research shows folic acid in grains has reduced birth defects

...to save thousands of babies from being born with a disabling or fatal birth defect with such a simple, low-tech means as folic acid fortification," says Dr. Jennifer L. Howse, president of the March of Dimes. "Studies have shown that adequate daily folic acid intake beginning before pregnancy can reduce the i...

Researchers discover gene mutations associate with a chronic pain syndrome

... (also called HNA). No treatment is known for this disabling condition, which short-circuits a peripheral nerve center called the brachial plexus, a network of over 100,000 nerves, that branches from the spinal cord to supply muscular function and sensation to the shoulders, arms, and hands. HNA may first appe...

New approach to multiple sclerosis research hopes to find more effective treatments, cure

...medical researchers. MS is a chronic, potentially disabling disease that affects the central nervous system and typically strikes individuals during their early adult years. The disease can be especially devastating due to the profound disability associated with its progression and its economic impact, since ...

Javits Award funds neurology of animal movement study

...s suffered from amyotrophic lateral sclerosis, the disabling neurodegenerative disorder also known as Lou Gehrig's disease. A component of the National Institutes of Health, the NINDS is the nation's primary federal sponsor of research on the brain and nervous system....

1 2 3 4

(Date:5/21/2013)... battle? Try staying fit in space, where living quarters ... , That,s the challenge a group of Michigan State ... million grant from NASA. Their goal is to keep ... "You could give astronauts the best exercise regimen there ... to it, it isn,t going to help," said project ...
(Date:5/21/2013)... biomass experts , Where? Copenhagen, Denmark: ... 03-07 June 2013 , Why? ... market and policy developments, manufacturing and installation, drawing on ... from its 2013 edition from a record of more ... more than 240 plenary and oral presentations, more than ...
(Date:5/21/2013)... The epigenetic modifications, which alter the way genes ... apparently be detected in the blood of pregnant ... way to foretell depression in the weeks after ... symptoms become debilitating. , The findings of the ... online in the journal Molecular Psychiatry . ...
Breaking Biology News(10 mins):Fueling fitness on the final frontier 221st European Biomass Conference and Exhibition 221st European Biomass Conference and Exhibition 321st European Biomass Conference and Exhibition 4Genetic predictors of postpartum depression uncovered by Hopkins researchers 2Genetic predictors of postpartum depression uncovered by Hopkins researchers 3
Other Tags
deficitmammarymissilesguidedcoloradoinfluencesculturealoneopensdocumentedruinousmethamphtetamineflycheckfacedmetacognition