Tag: "iii" at biology news

BDSI announces positive phase III clinical trial results

... The results demonstrated that patients treated with BEMATM Fentanyl showed a statistically significant improvement on the primary efficacy endpoint at 30 minutes (SPID...

NIH announces phase III clinical trial of creatine for Parkinson's disease

... The double-blind, placebo-controlled, phase III study is one of the largest PD clinical tri...

The Parkinson's Institute to conduct Phase III Clinical Trial of creatine for Parkinson's disease

... The double-blind, placebo-controlled, p...

Phase III trials of cellulose sulfate microbicide for HIV prevention closed

... Simultaneously, Family Health International (FHI) has halted a second Phase III cellulose sulfate trial in Nigeria. Although the FHI trial did n...

Eculizumab is well-tolerated and shows significant improvement in PNH patients (Ph III)

Cheshire, Conn., December 9, 2006 Eculizumab, a novel monoclonal antibody investigational drug developed by Alexion Pharmaceuticals, Inc. (Nasdaq: ALXN), appeared to be safe and well tolerated and provided clinically and statistically significant improvements in intravascular hemolysis, anemia, fatigue and quality of life in patients with paroxysmal nocturnal hemoglobinuria (PNH) during the 52...

T-beta-RIII joins the fight against breast cancer

Although the soluble factor TGF-beta has been shown to suppress the growth of tumor cells in the early stages of breast cancer, high levels of TGF-beta during the later stages of the disease are associated with a poor outcome. A study using human breast cancer samples and mice, which appears online on December 7 in advance of publication in the January print issue of the Journal of Clinical Inve...

Five Spanish hospitals in international phase III trial with H5N1 influenza pandemic vaccine

Both governments and the scientific community are mobilised to face the threat of a possible pandemic provoked by avian influenza. Whereas there is no need to alarm the population, we must design tools in order to fight influenza in case it develops. According to historical data and to the high genetic variability of influenza virus, the development of this pandemic is only a matter of time and t...

Advanced Membrane Technology III: Membrane engineering for process intensification

The conference will address the progress in membrane engineering and its strong relation with the process intensification strategy. Topics such as integrated membrane operations; new membrane operations such as membrane contactors and catalytic membrane reactors will be featured and industrial contributions will be emphasized. In addition, water desalination, exergetic analysis of membrane operat...

UCB presents positive CIMZIA results from pivotal PHASE III Crohn's disease trial at major US medical meeting

Honolulu, Hawaii, October 31, 2005 - A single 400 mg injection of Cimzia (certolizumab pegol, CDP 870) every four weeks was effective in maintaining control of the signs and symptoms of Crohn's disease following induction therapy, according to pivotal phase III research presented this week at the annual meeting of the American College of Gastroenterology.... ...The study, entitled PRECiSE 2, foun...

Attacks of King George III's madness linked to key metabolism molecule

BOSTON--Dana-Farber Cancer Institute researchers say they have uncovered a molecular explanation for the episodic attacks of irrational and demented behavior in porphyria, the disease believed to have afflicted "Mad" King George III, the British ruler blamed for the loss of the American colonies in the Revolutionary War....... The mental and physical symptoms of porphyria, a rare genetic blood di...

Certolizumab pegol demonstrates positive results in two Phase III Crohn's disease trials

Atlanta, Georgia, July 26, 2005 - UCB today announced positive results for the two pivotal Phase III trials (PRECISE 1 and 2) of certolizumab pegol (CDP870) in the induction and maintenance of clinical response in moderate to severe active Crohn' ......Data from PRECiSE 1 and 2 will be presented in more detail at the major forthcoming gastroenterology medical congresses.... ... About Crohn...

Phase III clinical program evaluates lubiprostone

BETHESDA, MD May 16, 2005 Takeda Pharmaceuticals North America (TPNA) and Sucampo Pharmaceuticals announced the initiation of a phase III clinical development program for lubiprostone in patients with constipation-predominant irritable bowel syndrome (IBS-C). Enrollment for these trials begins this month. Lubiprostone is an investigational compound currently being evaluated by the FDA for th...
(Date:8/28/2014)... -- Scientists have identified the developmental on-off switch for ... produce more than two-thirds of the world,s naturally derived ... to see whether it is possible to manipulate this ... , The study, appearing August 28 in Cell ... molecule called cyclic-di-GMP and a larger protein called BldD ...
(Date:8/28/2014)... method for measuring and imaging how quickly blood flows ... understand how drug abuse affects the brain, which may ... lead to better treatment options for recovering drug addicts. ... from Stony Brook University in New York, USA and ... in The Optical Society,s (OSA) open-access journal ...
(Date:8/28/2014)... the first person to alert the world to Global ... be captured and stored underground. He says that Carbon ... the best way to avoid global warming getting out ... (Columbia University, New York) made the call during his ... where 150 scientists are meeting to discuss Carbon Capture ...
Breaking Biology News(10 mins):Small molecule acts as on-off switch for nature's antibiotic factory 2Small molecule acts as on-off switch for nature's antibiotic factory 3This is your brain's blood vessels on drugs 2This is your brain's blood vessels on drugs 3Global warming pioneer calls for CO2 to be taken from atmosphere and stored underground 2
Other Tags
speedycootsovulationperimenopausalpeeksgenesystemsstrepasidewallsbumpdegradationimmunitiesbrandedpolymerpurduesexes