Tag: "physiological" at biology news

Diverse genetic abnormalities lead to NF-κB activation in multiple myeloma

... accumulation of malignant plasma cells beyond the physiological control of the bone marrow compartment. Our results suggest a mechanism by which MM cells can overcome these limitations through acquisition of mutations that result in constitutive and ligand-independent activation of the alternative NF-κB path...

Cardio exercise benefits in male vs. female hearts

...mechanisms behind the differences are unknown, the physiological differences are clear. A new study examining chron...iovascular disease. Frequent exercise leads to the physiological remodeling (change) and hypertrophy (beneficial enlargement) of the heart. This type of hypertrophy ...

Disabling a sensory organ prompts female mice to act like male mice

... science a new avenue to explore the molecular and physiological pathways that lead to differences in sexual behavior, according to Dulac. "Now we can really approach things from a mechanistic point of view," she said. "We can trace signaling events in the brain and see how brain areas controlling sex-specific beh...

Census of Marine Life historians detail collapse of bluefin tuna population off northern Europe

...uefin get warm when they undergo courtship and our physiological measurements indicate they are vulnerable to overheating while in the Gulf of Mexico. Gulf of Mexico eddies tornado-like features that move counter-clockwise and cause a retention of food -- may also play an important role in the bluefins breeding...

How cells change the pace of their steps

...other mammals, cell motility is essential for many physiological processes such as tissue renewal and the function of the immune system. Cell motility also is an essential part of embryonic development as fetal cells undergo an orchestrated migration to form functioning tissues and organs. Poorly regulated cell mo...

ESA announces 2007 award recipients

...it. Lange is one of the founding fathers of plant physiological ecology, and his impact on the field has been vitally important. He has 368 publications on the topic (92 since his retirement), has co-edited 10 books, and is still actively publishing today. He is a dedicated teacher and his scholarship is widespre...

Military to study better pain relief in battle zones

...ow well they perform several tasks under simulated physiological conditions in the laboratory. Ultimately, they want the particles to be able to: control the release of morphine over extended periods before a soldier can be evacuated to a military acute care facility, continuously monitor the soldiers brea...

Isoprene emission from plants -- a volatile answer to heat stress

...f temperature and isoprene emission in plants, the physiological role of isoprene emission, which is clearly quite costly to the plant, is still under vigorous debate. One of the most popular hypotheses suggests that isoprene protects the metabolic processes in the leaf, in particular photosynthesis (the process...

$9M grant awarded to University of Cincinnati for bipolar disorder research

... phases of illness. They will then view the brains physiological response to two mechanistically different, but widely used FDA-approved medications prescribed to treat bipolar disorder. More than 400 people will be recruited for this study. We think that by viewing whats happening in people very early before bi...

JCI table of contents -- July 26, 2007

...r of T cells) was recently identified, however its physiological function remained unclear. In a study appearing online on July 26 in advance of publication in the August print issue of the Journal of Clinical Investigation, Amnon Altman and colleagues from the La Jolla Institute for Allergy and Immunology studied...

Discoverer of Sly Syndrome finds way of delivering medicine to fight rare genetic disorder

...., professor of geriatrics and pharmacological and physiological sciences at Saint Louis University, and a leading researcher on the blood-brain barrier. Sly Syndrome, which occurs in fewer than one in 100,000 births, is a progressive disorder that ranges in severity from mild to deadly. It is among a group of g...

Researchers watch antibiotics, bacteria meet at atomic level

...s completion. This structure is important from a physiological point of view, not only for antibiotic design, but also because faults in the complex have been implicated in many diseases such as hereditary cancers. Artsimovitch and her colleagues used the bacterium Thermus thermophilus to run their experiments...

Switchable adhesive

...ents that could release their cargo under specific physiological conditions....

Eat fish -- especially if you drink high levels of alcohol

...growth and development, infertility, and a host of physiological and biochemical abnormalities." Salem is also the study's corresponding author. The most important EFAs are polyunsaturated fatty acids (PUFA), said J. Thomas Brenna, professor of human nutrition and of chemistry & chemical biology at Cornell Univ...

UB scientist discovers novel iron-copper alliance

...nduction of the Atp7a and Dmt1 genes" and 3) Which physiological processes related to intestinal iron ion homeostasis are enhanced by increased copper levels in enterocytes (cells of the superficial layer of the intestines) and in the liver" We also expect to learn more about the mechanisms of dietary copper absor...

New proteomics research promises to revolutionize biomedical discovery

...ecular maps that represents the fingerprint of the physiological status of normal human cells and the signature of some disease conditions. If this comprehensive repertoire of protein interaction networks, termed the Human Proteotheque, can assist scientists worldwide in identifying important new proteins that can...

Charting ever-changing genomes

...eaf-munching insects. In response, plants mobilize physiological and biochemical defenses that help them survive. We expected certain classes of genes to be highly variable due to natural selection in different environments. Both studies revealed precisely which gene family members indeed were shaped by evolution,...

Has science unearthed the Holy Grail of pain relief?

...acute pain associated with trauma, has no apparent physiological benefit, often being referred to as the disease of pain. Complete and lasting relief of chronic pain is rare and often the clinical goal is pain management through one or more medications. But now researchers at The University of Manchester have ...

Norwegian council names ASU researcher 'Outstanding Young Investigator'

...port her research in understanding the genetic and physiological basis of life history regulation in honeybees at t...es. Amdam has made key discoveries in the genetic, physiological and behavioral mechanisms underlying division of labor, caste development, and has advanced understa...

News tips from the Journal of Neuroscience

...ell dendrites within the molecular layer. However, physiological studies found that tonic inhibition was still present. The 2 subunits shifted toward perisynaptic locations in the epileptic mice in parallel with a decrease in phasic inhibition. The authors suggest that receptors containing 4 and relocated 2 may un...

1 2 3 4 5 6 7 8 9 10

(Date:10/16/2014)... Post-menopausal women experienced improvements in vaginal atrophy, with ... bleeding, after 12 weeks of daily 10 milligram ... nutritional supplement previously shown to help relieve certain ... study reported in a poster at the North ... , "These data documented improved vaginal epithelium, without ...
(Date:10/15/2014)... has admitted Johannes Gutenberg University Mainz (JGU) as ... hub continues to maintain a significant nationwide standing ... "The acceptance of Johannes Gutenberg University Mainz as ... milestone in the national and international competition for ... of Rhineland-Palatinate can be proud that Mainz University ...
(Date:10/15/2014)... 15, 2014   Neurotechnology , a provider ... availability of the VeriLook Surveillance 3.0 software ... real-time biometric face identification using live video streams ... The new version not only identifies faces in ... objects while they are moving through the video ...
Breaking Biology News(10 mins):S-equol supplements associated with improved measures of reproductive health in postmenopausal women 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 2Johannes Gutenberg University Mainz joins Germany's Gauss-Allianz as a full member 3VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 2VeriLook Surveillance 3.0 SDK Identifies Faces and Moving Objects, Differentiates Pedestrians from Other Moving Objects in Video Surveillance Systems 3
Other Tags
doublecortindirectingpayloadsstsmaintenancetelomerealivedrunkenapplesdevicewidelyisraeliimpactmonitoringneurodegenerativeions