The Latest Biology News And Medical NewsBiology News 2Health News 2Biology News 3Health News 3


Tag: "abraxis" at biology news

UCLA's California NanoSystems Institute partners with Abraxis BioScience

... Abraxis BioScience will collaborate with the institute and its team of leading researchers to capitalize on the recent explosion in nanoscience and to chart the future of nanotechnology within biotechnology. Abraxis has agreed to contribute $10 million over 10 years to fund collaborative projects at UCLAs new CNSI building. The...
(Date:12/1/2008)...ineered crops, sequencing the genome could be cons...e sequence is complete, the baton is passed forwar...raft sequence of the soybean genome is now availab.... Taking the next step in a new study, University ...ers have demonstrated the applicability of a genom...
(Date:12/1/2008)...ournal of the American Dietetic Association featu...ng habits of consumers. Researchers look at why fa...methods for adding healthier foods to a person,s d...Journal of the American Dietetic Association inclu... Reasons among Frequent Consumers, Menu Modeling ...
(Date:12/1/2008)...f sea and land animals around a group of Antarctic...sity and has more species than the Galapagos. The ...ow they will respond to future environmental chang...eography , the team from British Antarctic Survey ...d the land, sea and shores of the South Orkney Isl...
(Date:12/1/2008)...role in protecting us from diseases, but how does ...lden discovered that before dendritic cells move t...s helps them to move much faster. Immature dendrit... After exposure to such antigens they undergo a ri...the dendritic cells migrate to the lymph nodes to ...
Breaking Biology News(10 mins):Tool helps identify gene function in soybeans 2News from the December 2008 Journal of the American Dietetic Association 2Immune cells reveal fancy footwork 2Tolerance to inhalants may be caused by changes in gene expression 857 1Tolerance to inhalants may be caused by changes in gene expression 857 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 1Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 2Capps to Lead Bipartisan Womens Caucus Congressional Delegation to Represent United States at Women Deliver Conference in London 3933 3Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 1Jenny McCarthy Featured at National Autism Conference in Atlanta November 9 3931 2Greenway Medical Technologies Executive Testifies Before Congress 3929 1Greenway Medical Technologies Executive Testifies Before Congress 3929 2Greenway Medical Technologies Executive Testifies Before Congress 3929 3
Other Tagsretrieval 2eight 2eight 3eight 4eight 5eight 6eight 7eight 8eight 9eight 10surface 2surface 3surface 4surface 5surface 6surface 7surface 8surface 9surface 10
whopperstweakstelangiectasiaprimetimespectragyroscopeswooretrievaleightundiscoveredseethessurfacelaryngealanticholinergicsubwaycbs