Tag: "activity" at biology news

A sensory organ, not the brain, differentiates male and female behavior in some mammals

... mature female mouse brain may require vomeronasal activity to repress male behavior." To test these two alt...emale mouse brain, but are repressed by the normal activity of the vomeronasal organ." "In fact, our research suggests a new model where exactly the same neur...

Identified mechanism in the malaria parasite to help it adapt to infected individuals

...pecific epigenetic modifications are associated to activity or to silencing. Another immediate objective is to find out how many of the 30 genes involved in the invasion of red blood cells are active or inactive in parasites found in nature. Thanks to this study we have been able to identify 7 genes in 4 diff...

Chickadee, nutchatch presence in conifers increases tree growth, says CU-Boulder study

...ponderosas throughout the West. Mooney said the activity of the birds also was shown to change the chemical... carbohydrate-high "honeydew" secretions - feeding activity by birds can disrupt this relationship, triggering aphid population decreases and increases in tree ...

Altering a protein makes mice less fearful

...ows that mice without ASIC1a have altered neuronal activity in these fear circuit structures. The researchers speculate that because the gene is localized to brain regions involved in fear, targeting the ASIC1a protein might have a more focused effect on anxiety with fewer side effects than existing treatme...

Handicapping tuberculosis may be the way to a better vaccine

...is team hypothesized that eliminating this enzymes activity would give macrophages the opportunity to trigger apoptosis, thus prompting a more effective immune response. So the researchers deleted the gene responsible for shuttling sodA out of the bacterium, effectively disabling sodA activity. When they com...

New study demonstrates important role of glia in circadian timing

...glial mechanism may drive circadian rhythms in the activity of a Drosophila protein known as Ebony, says F. Ro...e CNR and professor of neuroscience at TUSM. Ebony activity and the glia containing that activity explains Jackson, function independently of, or in concert wit...

Molecule blocks gene, sheds light on liver cancer

...h shows how a particular small molecule blocks the activity of a cancer-suppressing gene, allowing liver-cancer cells to grow and spread. This molecule is a microRNA, a recently discovered class of tiny molecules used by cells to help control the kinds and amounts of proteins they make. More than 250 diffe...

Cost-effective method for gene silencing is featured in Cold Spring Harbor Protocols

...blished today include methods for imaging neuronal activity in zebrafish, examining gene expression patterns in fruit flies and frogs, preparing DNA from mammals for genotyping, and identifying protein-protein interactions in virtually any species. For a complete list of articles in the August release of Co...

Reading a face is tricky business

... a new Northwestern University study of electrical activity in the brain. Though such microexpressions as a...wing subliminal emotional expressions, their brain activity was altered within 200 milliseconds, said Ken Paller, co-investigator of the study and professor of ...

Huntington's disease study shows animal models on target

...nt huntingtin protein modifies the transcriptional activity of genes in affected neurons. This disease mechani...s of the protein hungtintin in the transcriptional activity of neurons. They then designed and implemented novel computational methods for quantifying similarit...

Defining the active site of Bax

...ionship between homo-oligomerization and apoptotic activity of Bax and the identification of the Bax homo-oligomerization domain represent one step forward towards answering that question," explains Dr. Luo....

News tips from the Journal of Neuroscience

...flexible (plastic) in response to ongoing neuronal activity is not limited to synapses, as Pratt and Aizenman ...sence of auditory stimuli. They recorded the spike activity in single AN fibers in anesthetized cats, then used the distributions of the interspike intervals (I...

Research shows NPD1 protects a key component of vision

... elicits a specific action rather than antioxidant activity to counteract A2E-induced cell death in RPE cells. One of these papers reports also the discovery that the daily interaction of photoreceptors and RPE cells balance against damage is maintained by NPD1. The regulation of these proteins involved in ...

MIT model could predict cells' response to drugs

...s approached the problem quantitatively, measuring activity levels in five major signaling pathways after colo...l correlating outcomes with the combined levels of activity in the multiple pathways. The model was then used to correctly predict what would happen to two othe...

Using stem cells to help heart attack victims

...rovide more detailed information on the electrical activity of stem cell derived cardiomyocytes. In the longer term, this could facilitate their use in regenerating the damaged hearts of heart attack victims. Dr Chris Denning, of the Universitys Wolfson Centre for Stem Cells, Tissue Engineering & Modelling...

Risk genes for multiple sclerosis uncovered

...lled the IL-7 receptor, which helps to control the activity of a class of immune cells called regulatory T cells. Two papers appearing simultaneously in Nature Genetics confirm this finding, and explore how the change in the IL-7 receptor affects the immune system. I believe that this receptor and its interac...

System to analyze beating heart stem cells could lead to heart attack treatments

...rovide more detailed information on the electrical activity of stem cell derived cardiomyocytes. In the longer term, this could facilitate their use in regenerating the damaged hearts of heart attack victims. Human embryonic stem cells promise unrivalled opportunities. However, they are difficult, time-con...

Strength of connections between brain regions may affect an adolescent's response to peer influence

... They found that the brains of all children showed activity in regions important for planning and extracting i...uence. These children were also found to have more activity in the prefrontal cortex, an area important for decision making and inhibition of socially inappropr...

New target for HIV/AIDS drugs and vaccine discovered

... the discovery of suitable drugs able to block the activity of this smart protein. Quaranta added, An exciting possibility is the design of a vaccine including a mutated Nef protein unable to assist the virus in the control of its host. The research findings also raise another intriguing possibility: Nef pr...

$9M grant awarded to University of Cincinnati for bipolar disorder research

...ptoms of a manic episode include increased energy, activity and restlessness, excessively high or overly euphoric mood, and extreme irritability. In contrast, a depressive episode is characterized by a lasting sad, anxious, or empty mood, feelings of hopelessness or pessimism, and decreased energy. An NIMHs...

1 2 3 4 5 6 7 8 9 10

(Date:6/17/2013)... 2013 An international team led by scientists at ... Institute and Albert Einstein College of Medicine of Yeshiva ... that attacks the tuberculosis (TB) bacterium in two different ... solve one of the major global health crises of ... strains," said Peter G. Schultz, the Scripps Family Chair ...
(Date:6/17/2013)... ST. LOUIS -- In research published in Biochemical ... describe a technology that can detect new, previously unknown ... for viruses even when doctors have not identified a ... , In the new approach, scientists use ... discover viruses. , Taking advantage of the complete deciphering ...
(Date:6/17/2013)... early onset of puberty in girls, a new clinical ... Endocrine Society,s 95th Annual Meeting in San Francisco. , ... 10 and 14. Boys undergo these changes later, usually ... is diagnosed in girls when sexual development begins before ... when these changes occur before age 9. , Recently, ...
Breaking Biology News(10 mins):New compound excels at killing persistent and drug-resistant tuberculosis 2New compound excels at killing persistent and drug-resistant tuberculosis 3New compound excels at killing persistent and drug-resistant tuberculosis 4Saint Louis University researchers discover a way to detect new viruses 2Saint Louis University researchers discover a way to detect new viruses 3Vitamin D supplementation may delay precocious puberty in girls 2
Other Tags
capillarymaterialisemisshapentacticsoupamchitkapassivelawnsstaraffirmsmelodyunbornregretbeverageassurefao