Tag: "actors" at biology news

Linking empires, economics, evolution

...me general direction: toward larger, more powerful actors that dominate their environment and its resources. But these large, dominant groups are also more vulnerable to sudden disruptions. Vermeij studies the shells of marine animals both living and long extinct. Blind since childhood, he works entire...

Study reveals developing countries with recipe for thriving health biotech industries

...h, business, policy, health institutions and other actors in the field and ensure an active knowledge flow among them have been the most successful," says Dr. Thorsteinsdttir. Specialization Produces Cost-effective Results Focusing on a niche area is yet another successf...

Understanding biological foundation of human behavior critical to improving laws

...s to assume that either people are purely rational actors or that their brains are blank slates on which culture and only culture is written. The reality is much more complicated and can only be appreciated with a deeper understanding of behavioral biology," said Vanderbilt law professor and biologist Owen ...

Salk Institute scientist Rusty Gage elected to American Academy of Arts and Sciences

...at recognize not just scientists but also artists, actors and other non-scientists. "While honors such as this are wonderful, they remind me that individual successes are made possible by through creative and supportive, colleagues and family," added Gage, who co-heads the Salk Institute's Laboratory of Gen...

A 2002 disease threat offers lessons for avian flu preparedness

...ement perspective, networks are a set of connected actors involved in the delivery of services. These multiple organizations depend on each other and interact outside of a traditional hierarchy. To succeed, such networks of responders generally rely on a mixture of centralized formal command and control, an...

Mathematics in fact and fiction discussed at AAAS Annual Meeting

... after the show's premiere. While the writers and actors inevitably use some dramatic license in their portrayal of mathematicians and their world, he said, "at heart they get the mathematician and the math right."...

World experts gather in New York to discuss the feasibility of sustainable development

... 06 speakers are among the world's most recognized actors and thinkers in their fields, including scientific research, media, business and international development. In this open forum, each of these experts will present new research, question prevailing ideas and/or propose bold actions that may help more ...

Opportunities for structured doctoral research

...nvestigate how citizens organise themselves as the actors of civil society and how they act in the state and the market in response to changing political structures. (Spokesperson: Professor Friso Wielange, University of Mnster) The International Research Training Group "The Structure of Supramolecular Fu...

Small-scale logging leads to clear-cutting in Brazilian Amazon

...ed--loggers versus ranchers and farmers--and those actors are treated differently by government regulators. The remote sensing system has a spatial resolution of 98 feet by 98 feet. Through advanced computational methods, the scientists can determine the level of canopy damage and how long it takes to gro...

Progress in battle against life-threatening acute allergy

... searching for better remedies. Several leading actors Scientists are aware of the possible role of PAF ...o verify whether inhibition of the several leading actors could prevent anaphylactic shock. And indeed, from their research it turns out that inhibition of eN...

Call for global action over continued huge burden of maternal deaths in poor countries

...echanisms to hold all countries, donors, and other actors to account. Dr. Oona Campbell, Reader in Epidemiology and Reproductive Health at LSHTM, and Professor Wendy Graham, Professor of Obstetric Epidemiology at the University of Aberdeen, the authors of the second paper in the series, conclude: 'In sign...

Most important actors in the growth process of neurons identified

...t and FGF signaling cascades as the most important actors and have also discovered their respective roles. Their research shows that the growth of axons and the activity of neurons are completely independent of each other. This new finding can lead to better understanding of a variety of nerve diseases. A...

Fishy cooperation

...is study is that the entire interaction patterntwo actors who seemingly know what they are going to do and how this will benefit themis not one we usually associate with fish. This is probably because we tend to develop cognitively demanding accounts for our own behavior and believe that absent the same cog...

ESA launches new project to protect biodiversity

...rvation and monitoring activities of the different actors involved in UNCBD in Central America. ESA has identified four main users: the United Nations Educational, Scientific and Cultural Organization (UNESCO), the Secretariat of the UNCBD, the Centro American Commission for Environment and Development (CCA...

ESA's Medspiration project branches out to support biodiversity

...rvation and monitoring activities of the different actors involved in UNCBD in Central America one of the main biodiversity reserves on our planet. Other services and products will include Mesoamerican biological corridor change detection maps, coral reef maps, ocean water quality monitoring services, mang...

Freeze! Scientists film proteins at work by freezing them at different states

...oble (France) have managed to produce a movie. The actors are not celebrities but a protein whose role is to eliminate toxic molecules. They filmed this protein in action by freezing it at several states. They publish their results this week in Science. Most of the research done on proteins is based on t...

1

(Date:5/17/2013)... Shenzhen, China---- Why Tibetan antelope can live at ... a collaborative research published in Nature Communications ... institutes provide evidence that some genetic factors may ... highland environments. The data in this work will ... and the biology of other ruminant species. , ...
(Date:5/17/2013)... team of scientists using a new X-ray method recorded ... frog embryo in greater detail than ever before., This ... and the search for new treatments for genetic diseases., ... Technologie in Germany, in collaboration with the Advanced Photon ... Laboratory, released the most precise depiction ever of the ...
(Date:5/16/2013)... fast food restaurant had a higher body mass index ... food, according to researchers at The University of Texas ... strong among those with a lower income. , ... Journal of Public Health indicates higher BMI associates ... among lower-income African-Americans, the density, or number, of fast ...
Breaking Biology News(10 mins):The genome sequence of Tibetan antelope sheds new light on high-altitude adaptation 2New X-ray method shows how frog embryos could help thwart disease 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 2Body mass index of low income African-Americans linked to proximity of fast food restaurants 3
Other Tags
naturetoldentrepreneursrepellentsfiringmixesriboswitchespeekscryingnighttimechronicinfantsmaasiowacabonathan